Transcription Factor

Accessions: 1bc7_C (3D-footprint 20231221), 1bc8_C (3D-footprint 20231221)
Names: ELK4_HUMAN, ETS domain-containing protein Elk-4, ETS-DOMAIN PROTEIN, SAP-1, Serum response factor accessory protein 1, SRF accessory protein 1, SAP-1 ETS DOMAIN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P28324
Length: 93
Pfam Domains: 5-86 Ets-domain
Sequence:
(in bold interface residues)
1 MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLS 60
61 RALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM
Interface Residues: 57, 58, 60, 61, 62, 64, 65, 79
3D-footprint Homologues: 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A
Binding Motifs: 1bc7_C cATCCt
1bc8_C CGGAa
Binding Sites: 1bc8_A
1bc7_A
1bc7_B
1bc8_B
Publications: Mo Y., Vaessen B., Johnston K., Marmorstein R. Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.. Mol. Cell 2:201-212 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.