Transcription Factor

Accessions: 1au7_A (3D-footprint 20231221)
Names: GHF-1, Growth hormone factor 1, PIT1_RAT, Pituitary-specific positive transcription factor 1, PROTEIN PIT-1
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P10037
Length: 130
Pfam Domains: 3-71 Pou domain - N-terminal to homeobox domain
73-128 Homeobox domain
Sequence:
(in bold interface residues)
1 GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLK 60
61 AILSKWLEEAEQKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFC 120
121 NRRQREKRVK
Interface Residues: 23, 39, 40, 41, 42, 44, 45, 47, 48, 51, 55, 72, 73, 75, 113, 114, 116, 117, 120, 121, 124, 125, 128
3D-footprint Homologues: 3d1n_M, 7u0g_M, 3l1p_A, 2xsd_C, 1o4x_A, 7xrc_C, 8g87_X, 1e3o_C, 1au7_A, 2d5v_B, 1fjl_B, 5zfz_A, 6a8r_A, 3cmy_A, 1nk2_P, 6m3d_C, 2lkx_A, 3rkq_B, 2r5y_A, 4xrs_G, 2hos_A, 1b72_A, 1ig7_A, 5flv_I, 5zjt_E, 2h1k_B, 1jgg_B, 7psx_B, 5hod_A, 3lnq_A, 2hdd_A, 2ld5_A, 5jlw_D, 1le8_A, 7q3o_C, 1zq3_P, 6es3_K, 4cyc_A, 1du0_A, 4qtr_D, 3a01_E, 1puf_A, 4xrm_B
Binding Motifs: 1au7_A TGTATATaCAT
1au7_AB tcATGTATATACAT
Binding Sites: 1au7_C
1au7_D
Publications: Jacobson E.M, Li P, Leon-del-Rio A, Rosenfeld M.G, Aggarwal A.K. Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility. Genes & development 11:198-212 (1997). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.