Transcription Factor

Accessions: T151164_1.02 (CISBP 1.02), A2X7K8 (JASPAR 2018)
Names: OsI_08196, T151164_1.02;, A2X7K8_ORYSI
Organisms: Oryza sativa, Oryza sativa Indica Group
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
Notes: experiment type:PBM, family:TCP
Length: 210
Pfam Domains: 54-147 TCP family transcription factor
Sequence:
(in bold interface residues)
1 MSSRDAAATFHVYQPVQIPTATVAPAAAVSAAPAEAVAQLVPAPSKKAAGAAGGKDRHSK 60
61 VNGRGRRVRMPIVCAARVFQLTRELGLKSDGQTIEWLLRQAEPAILAATGTGTTPAAFVS 120
121 SSAPSTSSHQHTLLGKRQRQESAAADAVSVAGAASAFWAALPAPGRPDAWGFSPLDAQPT 180
181 YVPMAQAHHHHLNLLAALSGAARRAEEESR
Interface Residues: 153, 155
3D-footprint Homologues: 5yx2_D
Binding Motifs: M1658_1.02 GGGCCCAC
MA1050.1 GGGCCCAC
Publications: Viola I. L., Uberti Manassero N. G., Ripoll R., Gonzalez D. H. The Arabidopsis class I TCP transcription factor AtTCP11 is a developmental regulator with distinct DNA binding properties due to the presence of threonine at position 15 of the TCP domain.. Biochem. J. 435:143 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.