Transcription Factor
Accessions: | 5yeg_A (3D-footprint 20231221) |
Names: | 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P49711 |
Length: | 138 |
Pfam Domains: | 2-24 C2H2-type zinc-finger domain 2-24 C2H2-type zinc finger 17-38 Zinc-finger double domain 30-52 Zinc finger, C2H2 type 30-53 C2H2-type zinc-finger domain 30-52 C2H2-type zinc finger 45-69 Zinc-finger double domain 58-81 C2H2-type zinc finger 88-111 C2H2-type zinc finger 88-111 Zinc finger, C2H2 type 119-138 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 PFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYEC 60 61 YICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKC 120 121 RYCDAVFHERYALIQHQK |
Interface Residues: | 2, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 25, 40, 41, 42, 43, 44, 45, 46, 47, 48, 55, 68, 69, 70, 71, 72, 74, 75, 79, 99, 100, 101, 102, 105, 108, 129, 130, 131, 132, 135 |
3D-footprint Homologues: | 2kmk_A, 7y3l_A, 5v3j_F, 7n5w_A, 1tf3_A, 8ssu_A, 1ubd_C, 6ml4_A, 4x9j_A, 1mey_C, 6blw_A, 5kkq_D, 1f2i_J, 6u9q_A, 5ei9_F, 5kl3_A, 7ysf_A, 1g2f_F, 6wmi_A, 8ssq_A, 1tf6_A, 7w1m_H, 5und_A, 2gli_A, 8h9h_G, 4m9v_C, 7eyi_G, 2lt7_A, 2i13_A, 6e94_A, 2jpa_A, 3uk3_C, 8cuc_F, 8gn3_A, 2wbs_A, 7txc_E, 5yj3_D, 5k5i_A, 6jnm_A, 1llm_D, 6a57_A, 7y3m_I, 1yuj_A, 2drp_D, 5yel_A, 5k5l_F |
Binding Motifs: | 5yeg_A CGCCCTCTGCTGG |
Binding Sites: | 5yeg_C 5yeg_D |
Publications: | Yin M, Wang J, Wang M, Li X, Zhang M, Wu Q, Wang Y. Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites. Cell Res 27:1365-1377 (2017). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.