Transcription Factor

Accessions: T081042_1.02 (CISBP 1.02), A8XJN7 (JASPAR 2018)
Names: Cbr-fkh-2, T081042_1.02;, A8XJN7_CAEBR
Organisms: Caenorhabditis briggsae
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:Forkhead
Length: 279
Pfam Domains: 101-196 Fork head domain
Sequence:
(in bold interface residues)
1 MARFSILDLCPDLVEKAMNVQNGLVSMQSTLQLQAQKDINDPCTSIDSTTDIMSNPANDN 60
61 SDYLLDESVDDERSESTSSKDSKSPCSNSSDDKKPSSPNDKPPFSYNALIMMAIKNSPEK 120
121 RLTLAGIYDYILTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDAT 180
181 CEDEVFIGGATGKLRRRPSTLSRARMDAYKQYGAAAANLFPYFNPGLPPMPRTPFITTPP 240
241 TAFLPRPMMPMPSLAPVFTQPELIQMYLNQQQGLFAKLQ
Interface Residues: 141, 146, 147, 148, 150, 151, 152, 154, 155, 164, 171, 193, 197
3D-footprint Homologues: 3l2c_A, 2hdc_A, 5x07_F, 2c6y_A, 3g73_A, 1vtn_C, 2uzk_A, 2a07_K, 3co6_C, 3qrf_G
Binding Motifs: M0715_1.02 rTAAACAa
MA0920.1 rTAAACAa
Publications: Hedrick SM, Hess Michelini R, Doedens AL, Goldrath AW, Stone EL. FOXO transcription factors throughout T cell biology. Nat Rev Immunol 12:649-61 (2012). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.