Transcription Factor

Accessions: Q6XYB7 (JASPAR 2024)
Names: Ladybird homeobox 2, Ladybird homeobox protein homolog 2, LBX2_HUMAN, Transcription factor LBX2
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q6XYB7
Length: 198
Pfam Domains: 86-142 Homeobox domain
Sequence:
(in bold interface residues)
1 MNSGREPRTPRTLLSIADILAPRMVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLD 60
61 ARALQPSEGRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAT 120
121 RLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGP 180
181 AGPDSRPHLSDEEIQVDD
Interface Residues: 86, 87, 88, 89, 127, 128, 130, 131, 134, 135, 138, 139, 142
3D-footprint Homologues: 5zfz_A, 3d1n_M, 2h1k_B, 1ig7_A, 1puf_A, 6a8r_A, 1fjl_B, 3cmy_A, 1zq3_P, 1nk2_P, 1jgg_B, 3lnq_A, 2lkx_A, 2ld5_A, 7q3o_C, 6es3_K, 1b72_A, 3rkq_B, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 5zjt_E, 4cyc_A, 7psx_B, 5hod_A, 3a01_E, 5jlw_D, 4xrs_G, 2hdd_A, 1le8_A, 7xrc_C, 1ic8_B, 2xsd_C, 1e3o_C, 2h8r_B, 8g87_X, 1du0_A, 3l1p_A, 4qtr_D, 1puf_B
Binding Motifs: MA0699.1 rcyAATTArc
MA0699.2 yAATTA
Publications: Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.