Transcription Factor
| Accessions: | 1qn3_B (3D-footprint 20231221), 1qn4_B (3D-footprint 20231221), 1qn6_B (3D-footprint 20231221), 1qn8_B (3D-footprint 20231221), 1qnb_B (3D-footprint 20231221), 1qnc_B (3D-footprint 20231221), 1vol_B (3D-footprint 20231221), 6njq_A (3D-footprint 20231221), 6ueo_G (3D-footprint 20231221), 6ueq_B (3D-footprint 20231221), 6uer_A (3D-footprint 20231221) |
| Names: | AtTBP1, TATA sequence-binding protein 1, TATA-binding factor 1, TATA-box factor 1, TATA-box-binding protein 1, TBP-1, TBP1_ARATH, Transcription initiation factor TFIID TBP-1 subunit, TRANSCRIPTION INITIATION FACTOR TFIID-1, TATA BINDING PROTEIN (TBP) |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P28147 |
| Length: | 187 |
| Pfam Domains: | 12-94 Transcription factor TFIID (or TATA-binding protein, TBP) 99-185 Transcription factor TFIID (or TATA-binding protein, TBP) |
| Sequence: (in bold interface residues) | 1 VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTA 60 61 LIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLE 120 121 GLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPV 180 181 LSEFRKI |
| Interface Residues: | 16, 18, 46, 47, 61, 63, 69, 71, 105, 106, 108, 137, 138, 152, 154, 160, 162 |
| 3D-footprint Homologues: | 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D, 6cnb_R, 1cdw_A, 5iy6_P, 7z7n_D, 1qna_B |
| Binding Motifs: | 1vol_AB / 1vol_B cTtTTATA 1qn3_B TATAAaCg 1qn4_B aTtTTATA 1qn6_B TATAAtAg 1qn8_B CTTTAATA 1qnb_B AtTTATA 1qnc_B sTkTTATT 6njq_A GTTTATA 6ueo_G TATAAAAG 6ueq_B CTtTTATa 6uer_A cCtTTATA |
| Binding Sites: | 1qn3_E / 6njq_C / 6uer_C 1qn3_F / 6njq_D 1qn4_E 1qn4_F 1qn6_E 1qn6_F 1qn8_E 1qn8_F 1qnb_E 1qnb_F 1qnc_E 1qnc_F 6ueo_H 6ueq_D 1vol_C 1vol_D 6ueo_I / 6uer_D 6ueq_C |
| Publications: | Patikoglou G.A, Kim J.L, Sun L, Yang S.H, Kodadek T, Burley S.K. TATA element recognition by the TATA box-binding protein has been conserved throughout evolution. Genes & development 13:3217-30 (1999). [Pubmed] Nikolov D.B, Chen H, Halay E.D, Usheva A.A, Hisatake K, Lee D.K, Roeder R.G, Burley S.K. Crystal structure of a TFIIB-TBP-TATA-element ternary complex. Nature 377:119-28 (1995). [Pubmed] Stelling AL, Liu AY, Zeng W, Salinas R, Schumacher MA, Al-Hashimi HM. Infrared Spectroscopic Observation of a G-C(+) Hoogsteen Base Pair in the DNA:TATA-Box Binding Protein Complex Under Solution Conditions. Angew Chem Int Ed Engl 58:12010-12013 (2019). [Pubmed] Afek A, Shi H, Rangadurai A, Sahay H, Senitzki A, Xhani S, Fang M, Salinas R, Mielko Z, Pufall MA, Poon GMK, Haran TE, Schumacher MA, Al-Hashimi HM, Gordân R. DNA mismatches reveal conformational penalties in protein-DNA recognition. Nature 587:291-296 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.