Transcription Factor
Accessions: | T049269_1.02 (CISBP 1.02), Q6NZQ6 (JASPAR 2024) |
Names: | T049269_1.02;, Zfp740, ZN740_MOUSE |
Organisms: | Mus musculus |
Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q6NZQ6 |
Notes: | experiment type:PBM, family:C2H2 ZF |
Length: | 180 |
Pfam Domains: | 88-110 C2H2-type zinc finger 102-125 Zinc-finger double domain 116-138 Zinc finger, C2H2 type 116-138 C2H2-type zinc finger 130-154 Zinc-finger double domain 144-165 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 MMLSQIASKQAENGERAGSPDVLRCSSQMDCKPRFDLSSKGHRKDSDKSRNRKEDDSLAE 60 61 ASHSKKTVKKVVVVEQNGSFQVKIPKNFICEHCFGAFRSSYHLKRHVLIHTGEKPFECDV 120 121 CDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGCQSKTSEGQFSL 180 |
Interface Residues: | 88, 98, 99, 100, 101, 102, 104, 105, 107, 108, 111, 126, 127, 128, 129, 130, 132, 133, 134, 155, 156, 157, 158, 159, 160, 161, 162 |
3D-footprint Homologues: | 2kmk_A, 6jnm_A, 3uk3_C, 8cuc_F, 1tf3_A, 7y3l_A, 5v3j_F, 7n5w_A, 5ei9_F, 8ssq_A, 1mey_C, 7w1m_H, 5und_A, 8ssu_A, 6ml4_A, 2gli_A, 8gn3_A, 1g2f_F, 6blw_A, 5kkq_D, 1tf6_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 1ubd_C, 7ysf_A, 6wmi_A, 7eyi_G, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 2drp_D, 1f2i_J, 5k5i_A, 5yel_A, 1llm_D, 7txc_E, 2wbs_A, 5yj3_D, 4m9v_C |
Binding Motifs: | PB0100.1 ycyccCCCCCCmmwys PB0204.1 rrrtwCCCCCCggrrry M0429_1.02 wrtGGGGGGg M0430_1.02 mrtGGGGGgg |
Publications: | Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.