Transcription Factor

Accessions: T098489_1.02 (CISBP 1.02), Q9VJ02 (JASPAR 2018)
Names: Lim3, T098489_1.02;, Q9VJ02_DROME
Organisms: Drosophila melanogaster
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
Uniprot: Q9VJ02
Notes: experiment type:PBM, family:Homeodomain
Length: 440
Pfam Domains: 42-96 LIM domain
101-158 LIM domain
177-233 Homeobox domain
199-229 Homeobox KN domain
Sequence:
(in bold interface residues)
1 MELLKLMMFKSDFLSNGKCDDRVPPINLSQLPEFLLSTIPKCGGCHELILDRFILKVLER 60
61 TWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQDN 120
121 VYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKRPR 180
181 TTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGR 240
241 TRWSQYFRSMKGNCSPRTDKFLDKDELKVDYDSFSHHDLSNDSYSTVNLGLDEGASPHSI 300
301 RGSYMHGSSSPSQYPPSSRSPPPVGQGHTFGSYPDNIVYTNIDQAVGSSLHASKAHHRLH 360
361 SSNNVSDLSNDSSPDQGYPDFPPSPDSWLGDSGSTNTTSANNNANNNSSSSHNNNNSSGG 420
421 GSGGVSVSTAPNPSAPGVHY
Interface Residues: 176, 177, 178, 179, 180, 218, 219, 221, 222, 225, 226, 229, 230, 233
3D-footprint Homologues: 3a01_E, 4rdu_A, 1ig7_A, 2me6_A, 3cmy_A, 1fjl_B, 1puf_A, 2h1k_B, 2lkx_A, 3lnq_A, 1zq3_P, 1jgg_B, 1nk3_P, 2r5z_A, 3d1n_M, 2ld5_A, 1b72_A, 3l1p_A, 1puf_B, 5hod_A, 2hdd_A, 6es3_K, 5jlw_D, 2hos_A, 4xrs_G, 3rkq_B, 2d5v_B, 5lux_L, 1au7_A, 1gt0_C, 5eea_B, 4cyc_A, 1le8_A, 1e3o_C, 2xsd_C, 5z2t_D, 4cyc_B, 1le8_B, 4xrm_B, 4qtr_D, 1k61_B, 4rbo_D
Binding Motifs: MA0195.1 yTAATTA
M1092_1.02 cyaaTywvsy
Binding Sites: MA0195.1.18
MA0195.1.1
MA0195.1.10
MA0195.1.11
MA0195.1.12
MA0195.1.13
MA0195.1.14
MA0195.1.15
MA0195.1.16
MA0195.1.17
MA0195.1.19
MA0195.1.2
MA0195.1.20
MA0195.1.3
MA0195.1.4
MA0195.1.5
MA0195.1.6
MA0195.1.7
MA0195.1.8
MA0195.1.9
Publications: Noyes M.B, Meng X, Wakabayashi A, Sinha S, Brodsky M.H, Wolfe S.A. A systematic characterization of factors that regulate Drosophila segmentation via a bacterial one-hybrid system. Nucleic acids research 36:2547-60 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.