Transcription Factor

Accessions: AGL1 (Athamap 20091028), P29381 (JASPAR 2018)
Names: AGL1, Agamous-like MADS-box protein AGL1, AGL1_ARATH, Protein SHATTERPROOF 1
Organisms: Arabidopsis thaliana
Libraries: Athamap 20091028 1, JASPAR 2018 2
1 Bülow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed]
2 [Pubmed]
Length: 248
Pfam Domains: 24-73 SRF-type transcription factor (DNA-binding and dimerisation domain)
95-188 K-box region
Sequence:
(in bold interface residues)
1 MEEGGSSHDAESSKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL 60
61 VIFSTRGRLYEYANNSVRGTIERYKKACSDAVNPPSVTEANTQYYQQEASKLRRQIRDIQ 120
121 NSNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKNELLVAEIEYMQKREMELQHNNM 180
181 YLRAKIAEGARLNPDQQESSVIQGTTVYESGVSSHDQSQHYNRNYIPVNLLEPNQQFSGQ 240
241 DQPPLQLV
Interface Residues: 18, 19, 30, 33, 34, 38
3D-footprint Homologues: 1n6j_A, 1egw_B, 1hbx_D, 1mnm_A
Binding Motifs: MA0585.1 / AGL1 wtTdCCwwwwtgGGwAar
Publications: Huang H., Tudor M., Su T., Zhang Y., Hu Y., Ma H. DNA binding properties of two Arabidopsis MADS domain proteins: binding consensus and dimer formation.. Plant Cell 8:81-94 (1996). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.