Transcription Factor

						

			
Accessions: BCL6B (HT-SELEX2 May2017)

			
Names: BCL6B, ENSG00000161940
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: BTB/POZ_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: BTB/POZ_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 172
Pfam Domains:     20-43 C2H2-type zinc finger
    21-43 Zinc finger, C2H2 type
    21-43 C2H2-type zinc finger
    35-59 Zinc-finger double domain
    49-60 C2H2-type zinc finger
    49-71 Zinc finger, C2H2 type
    49-69 C2H2-type zinc finger
    49-67 Zinc-finger of C2H2 type
    63-87 Zinc-finger double domain
    76-87 C2H2-type zinc finger
    77-99 Zinc finger, C2H2 type
    77-99 C2H2-type zinc finger
   91-116 Zinc-finger double domain
  105-120 C2H2-type zinc finger
  105-127 Zinc finger, C2H2 type
  105-127 C2H2-type zinc finger
  120-143 Zinc-finger double domain
  133-156 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 AVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARFNR   60
  61 PANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTL  120
 121 KSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Interface Residues: 7, 11, 31, 32, 33, 34, 35, 37, 38, 40, 41, 42, 44, 49, 59, 60, 61, 62, 63, 65, 66, 70, 87, 88, 89, 90, 91, 93, 94, 115, 116, 117, 118, 119, 121, 122, 123, 125, 143, 144, 145, 146, 147, 148, 149, 150, 151
3D-footprint Homologues: 7w1m_H, 7y3l_A, 5v3j_F, 7n5w_A, 6wmi_A, 8ssq_A, 5und_A, 8ssu_A, 2gli_A, 8gn3_A, 5kkq_D, 1llm_D, 7eyi_G, 8h9h_G, 7y3m_I, 2i13_A, 5yel_A, 2jpa_A, 1ubd_C, 2kmk_A, 6jnm_A, 8cuc_F, 1tf3_A, 5ei9_F, 1mey_C, 1f2i_J, 5k5i_A, 6ml4_A, 1g2f_F, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 5kl3_A, 7ysf_A, 2lt7_A, 6e94_A, 5yj3_D, 2drp_D, 7txc_E, 6a57_A, 3uk3_C, 2wbs_A, 4m9v_C
Binding Motifs: BCL6B_3 btGCTTTCkAGGAAtk
BCL6B_4 ryGYAATCGAGGAAtt
BCL6B_methyl_1 ytGCTTTCTAGGAAtt
BCL6B_methyl_2 rcGTAATCTAGGAAtt
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.