Transcription Factor

Accessions: 3swp_C (3D-footprint 20231221)
Names: Abscisic-acid-responsive NAC, ANAC019, NAC domain-containing protein 19, NAC19_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9C932
Length: 135
Pfam Domains: 1-119 No apical meristem (NAM) protein
Sequence:
(in bold interface residues)
1 LPPGFRFYPTDEELMVQYLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKALFGEKEWYFF 60
61 SPRDRPNRVAGSGYWKATGTDKIISTEGQRVGIKKALVFYIGKAPKGTKTNWIMHEYRLI 120
121 EPSDDWVLCRIYKKQ
Interface Residues: 67, 76, 78, 80, 100, 104, 105, 106, 109
3D-footprint Homologues: 3swp_A, 7xp3_B
Binding Motifs: 3swp_ABCD CgnTTCnAnnnCGAAG
Publications: Welner D.H, Lindemose S, Grossmann J.G, Møllegaard N.E, Olsen A.N, Helgstrand C, Skriver K, Lo Leggio L. DNA binding by the plant-specific NAC transcription factors in crystal and solution: a firm link to WRKY and GCM transcription factors. The Biochemical journal 444:395-404 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.