Transcription Factor

Accessions: T000176_1.02 (CISBP 1.02), UP00452A (UniPROBE 20160601), P14164 (JASPAR 2018)
Names: ABF1, T000176_1.02;, ARS-Binding Factor 1, BAF1, OBF1, REB2, SBF1, ABF1_YEAST, Bidirectionally acting factor 1, DNA replication enhancer-binding protein OBF1, SFB-B
Organisms: Saccharomyces cerevisiae
Libraries: CISBP 1.02 1, UniPROBE 20160601 2, JASPAR 2018 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Hume MA, Barrera LA, Gisselbrecht SS, Bulyk ML. UniPROBE, update 2015: new tools and content for the online database of protein-binding microarray data on protein-DNA interactions. Nucleic Acids Res : (2015). [Pubmed]
3 [Pubmed]
Description: ARS-Binding Factor 1: DNA binding protein with possible chromatin-reorganizing activity involved in transcriptional activation, gene silencing, and DNA replication and repair
Notes: experiment type:PBM, family:ABF1
Length: 731
Pfam Domains: 8-134 BAF1 / ABF1 chromatin reorganising factor
321-507 BAF1 / ABF1 chromatin reorganising factor
Sequence:
(in bold interface residues)
1 MDKLVVNYYEYKHPIINKDLAIGAHGGKKFPTLGAWYDVINEYEFQTRCPIILKNSHRNK 60
61 HFTFACHLKNCPFKVLLSYAGNAASSETSSPSANNNTNPPGTPDHIHHHSNNMNNEDNDN 120
121 NNGSNNKVSNDSKLDFVTDDLEYHLANTHPDDTNDKVESRSNEVNGNNDDDADANNIFKQ 180
181 QGVTIKNDTEDDSINKASIDRGLDDESGPTHGNDSGNHRHNEEDDVHTQMTKNYSDVVND 240
241 EDINVAIANAVANVDSQSNNKHDGKDDDATNNNDGQDNNTNNDHNNNSNINNNNVGSHGI 300
301 SSHSPSSIRDTSMNLDVFNSATDDIPGPFVVTKIEPYHSHPLEDNLSLGKFILTKIPKIL 360
361 QNDLKFDQILESSYNNSNHTVSKFKVSHYVEESGLLDILMQRYGLTAEDFEKRLLSQIAR 420
421 RITTYKARFVLKKKKMGEYNDLQPSSSSNNNNNNDGELSGTNLRSNSIDYAKHQEISSAG 480
481 TSSNTTKNVNNNKNDSNDDNNGNNNNDASNLMESVLDKTSSHRYQPKKMPSVNKWSKPDQ 540
541 ITHSDVSMVGLDESNDGGNENVHPTLAEVDAQEARETAQLAIDKINSYKRSIDDKNGDGH 600
601 NNSSRNVVDENLINDMDSEDAHKSKRQHLSDITLEERNEDDKLPHEVAEQLRLLSSHLKE 660
661 VENLHQNNDDDVDDVMVDVDVESQYNKNTTHHNNHHSQPHHDEEDVAGLIGKADDEEDLS 720
721 DENIQPELRGQ
Interface Residues: 50, 51, 54, 55, 58, 309, 579, 580, 583, 587, 610
3D-footprint Homologues: 1w0t_A, 3m4a_A, 5g5t_A
Binding Motifs: M0001_1.02 TTATCACT
UP00452A_1 tcgTCaCgCyGyACGAarwrAt
MA0265.1 yCGTakrwartGAyaw
Binding Sites: AATATCAC
AATGATAT
AGATCACT
AGTGACAA
AGTGACAT
AGTGATAA
AGTGATAT
ATAGTGAT
ATATCACC
ATGTACGA
ATGTCACC
ATGTCACG
ATTATCAC
CCGTACAA
CCGTACGA
CGTACGAA
GAGTGACA
GTGACATA
TAGTGATA
TCGTACGA
Publications: Gordân R, Murphy KF, McCord RP, Zhu C, Vedenko A, Bulyk ML. Curated collection of yeast transcription factor DNA binding specificity data reveals novel structural and gene regulatory insights. Genome Biol : (2011). [Pubmed]

Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC and the Bulyk Lab/Brigham and Women’s Hospital do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.