Transcription Factor

						

			
Accessions: ECK120004790 (RegulonDB 7.5)

			
Names: FlhDC
Organisms: ECK12
Libraries: RegulonDB 7.5 1
1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed]
Notes: flagellum assembly; transcription, DNA-dependent; cytoplasm; flagellum; Transcription related; activator; operon; repressor; motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc); flagella; positive regulation of transcription, DNA-dependent; transcription activator activity; DNA binding; transcription repressor activity; flagellum organization
Length: 117
Pfam Domains:     1-102 Flagellar transcriptional activator (FlhD)
Sequence: MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAET
NQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRLLNDVNQPEEALRKKRA*
Binding Motifs: FlhDC SyTwwTTmsgsCswTw
Binding Sites: ECK120011334
ECK120011336
ECK120016598
ECK120016600
ECK120016602
ECK120016606
ECK120016608
ECK120016610
ECK120016612
ECK120016614
ECK120016733
ECK120016735
ECK120016737
ECK120016739
ECK120016742
ECK120016745
ECK120016747
			
Publications: Liu X., Matsumura P. The FlhD/FlhC complex, a transcriptional activator of the Escherichia coli flagellar class II operons. J Bacteriol. 176(23):7345-51 (1994). [Pubmed]


Claret L., Hughes C. Interaction of the atypical prokaryotic transcription activator FlhD2C2 with early promoters of the flagellar gene hierarchy. J Mol Biol. 321(2):185-99 (2002). [Pubmed]


Stafford GP., Ogi T., Hughes C. Binding and transcriptional activation of non-flagellar genes by the Escherichia coli flagellar master regulator FlhD2C2. Microbiology. 151(Pt 6):1779-88 (2005). [Pubmed]


Ikebe T., Iyoda S., Kutsukake K. Promoter analysis of the class 2 flagellar operons of Salmonella. Genes Genet Syst. 74(4):179-83 (1999). [Pubmed]


Barker CS., Pruss BM., Matsumura P. Increased motility of Escherichia coli by insertion sequence element integration into the regulatory region of the flhD operon. J Bacteriol. 186(22):7529-37 (2004). [Pubmed]


Bartlett DH., Frantz BB., Matsumura P. Flagellar transcriptional activators FlbB and FlaI: gene sequences and 5' consensus sequences of operons under FlbB and FlaI control. J Bacteriol. 170(4):1575-81 (1988). [Pubmed]


Campos A., Zhang RG., Alkire RW., Matsumura P., Westbrook EM. Crystal structure of the global regulator FlhD from Escherichia coli at 1.8 A resolution. Mol Microbiol. 39(3):567-80 (2001). [Pubmed]


Soutourina O., Kolb A., Krin E., Laurent-Winter C., Rimsky S., Danchin A., Bertin P. Multiple control of flagellum biosynthesis in Escherichia coli: role of H-NS protein and the cyclic AMP-catabolite activator protein complex in transcription of the flhDC master operon. J Bacteriol. 181(24):7500-8 (1999). [Pubmed]


Sperandio V., Torres AG., Kaper JB. Quorum sensing Escherichia coli regulators B and C (QseBC): a novel two-component regulatory system involved in the regulation of flagella and motility by quorum sensing in E. coli. Mol Microbiol. 43(3):809-21 (2002). [Pubmed]


Lehnen D., Blumer C., Polen T., Wackwitz B., Wendisch VF., Unden G. LrhA as a new transcriptional key regulator of flagella, motility and chemotaxis genes in Escherichia coli. Mol Microbiol. 45(2):521-32 (2002). [Pubmed]


Bertin P., Terao E., Lee EH., Lejeune P., Colson C., Danchin A., Collatz E. The H-NS protein is involved in the biogenesis of flagella in Escherichia coli. J Bacteriol. 176(17):5537-40 (1994). [Pubmed]


Wang S., Fleming RT., Westbrook EM., Matsumura P., McKay DB. Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription. J Mol Biol. 355(4):798-808 (2006). [Pubmed]


Shin S., Park C. Modulation of flagellar expression in Escherichia coli by acetyl phosphate and the osmoregulator OmpR. J Bacteriol. 177(16):4696-702 (1995). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.