Transcription Factor

Accessions: AtMYB65 (AthaMYB 1.0)
Names: 45591-47464, AtMYB65, Myb domain protein 65, MYB transcription factor, Putative Myb DNA-binding protein, Putative transcription factor
Organisms: Arabidopsis thaliana
Libraries: AthaMYB 1.0 1
1 Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Uniprot: Q9FR97
Length: 554
Pfam Domains: 43-90 Myb-like DNA-binding domain
46-106 Myb-like DNA-binding domain
96-139 Myb-like DNA-binding domain
100-143 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MSYTTATADSDDGMHSSIHNESPAPDSISNGCRSRGKRSVLKKGPWTSTEDGILIDYVKK 60
61 HGEGNWNAVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAKMGNKWAQ 120
121 MAEHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEIYVDDLHWSEEYTKSNIIRVDRRRR 180
181 HQDFLQLGNSKDNVLFDDLNFAASLLPAASDLSDLVACNMLGTGASSSRYESYMPPILPS 240
241 PKQIWESGSRFPMCSSNIKHEFQSPEHFQNTAVQKNPRSCSISPCDVDHHPYENQHSSHM 300
301 MMVPDSHTVTYGMHPTSKPLFGAVKLELPSFQYSETSAFDQWKTTPSPPHSDLLDSVDAY 360
361 IQSPPPSQVEESDCFSSCDTGLLDMLLHEAKIKTSAKHSLLMSSPQKSFSSTTCTTNVTQ 420
421 NVPRGSENLIKSGEYEDSQKYLGRSEITSPSQLSAGGFSSAFAGNVVKTEELDQVWEPKR 480
481 VDITRPDVLLASSWLDQGCYGIVSDTSSMSDALALLGGDDIGNSYVTVGSSSGQAPRGVG 540
541 SYGWTNMPPVWSL*
Interface Residues: 43, 78, 80, 81, 83, 84, 88, 89, 130, 131, 134, 135, 138, 139, 140
3D-footprint Homologues: 3sjm_A, 1w0u_A, 1iv6_A, 3osg_A, 1w0t_A, 2kdz_A, 1h8a_C, 3zqc_A, 6kks_A, 1mse_C, 1h89_C
Binding Motifs: AtMYB65_II GTTAGTTr
AtMYB65_I kkCrGTTr
Binding Sites: GTTAGTTA
GTCAGTTA
GTTAGTTG
TGCGGTTG
Publications: Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.