Transcription Factor
| Accessions: | opa (FlyZincFinger 1.0 ) |
| Names: | CG1133 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 175 |
| Pfam Domains: | 68-93 Zinc-finger double domain 81-105 C2H2-type zinc finger 81-105 Zinc finger, C2H2 type 97-124 Zinc-finger double domain 111-135 C2H2-type zinc finger 129-154 Zinc-finger double domain 141-165 C2H2-type zinc finger 141-165 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 QCLWIDPDQPGLVPPGGRKTCNKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGR 60 61 PFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDR 120 121 RFANSSDRKKHSHVHTSDKPYNCRINGCDKSYTHPSSLRKHMKVHGNVDEKSPSH |
| Interface Residues: | 27, 29, 30, 33, 36, 63, 64, 66, 67, 69, 70, 72, 73, 74, 76, 93, 94, 95, 96, 97, 99, 100, 101, 123, 124, 125, 126, 127, 128, 129, 130, 131, 134, 153, 154, 155, 156, 157, 159, 160 |
| 3D-footprint Homologues: | 5v3j_F, 2lt7_A, 7w1m_H, 8cuc_F, 1tf3_A, 5k5i_A, 2gli_A, 6ml4_A, 1g2f_F, 5kkq_D, 1tf6_A, 5ei9_F, 6e94_A, 7ysf_A, 6wmi_A, 2i13_A, 8gn3_A, 8h9h_G, 5und_A, 7eyi_G, 7n5w_A, 2jpa_A, 1ubd_C, 3uk3_C, 6jnm_A, 7y3l_A, 1llm_D, 7txc_E, 5kl3_A, 2kmk_A, 8ssq_A, 1mey_C, 1f2i_J, 4x9j_A, 6blw_A, 6u9q_A, 5yel_A, 4m9v_C, 7y3m_I, 6a57_A, 5yj3_D, 5k5l_F, 2wbs_A |
| Binding Motifs: | opa_NAR_FBgn0003002 GmCCCCCCGCtG opa_SOLEXA_FBgn0003002 mmmsmCCCCCCrcbG |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.