Transcription Factor

						

			
Accessions: CG31670 (FlyZincFinger 1.0 )

			
Names: CG31670
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 167
Pfam Domains:      2-22 C2H2-type zinc finger
     3-22 Zinc finger, C2H2 type
     3-23 C2H2-type zinc finger
    17-41 Zinc-finger double domain
    31-53 Zinc finger, C2H2 type
    31-45 C2H2-type zinc finger
    31-53 C2H2-type zinc finger
    48-69 Zinc-finger double domain
    58-79 C2H2-type zinc finger
    59-81 Zinc finger, C2H2 type
    59-78 C2H2-type zinc finger
    74-97 Zinc-finger double domain
   87-109 Zinc finger, C2H2 type
   87-109 C2H2-type zinc finger
  101-125 Zinc-finger double domain
  115-137 Zinc finger, C2H2 type
  115-125 C2H2-type zinc finger
  115-138 C2H2-type zinc finger
  129-152 Zinc-finger double domain
  143-166 C2H2-type zinc finger
  143-166 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHK   60
  61 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNIC  120
 121 NKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHE
Interface Residues: 3, 12, 13, 14, 15, 16, 17, 18, 19, 20, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 52, 54, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 80, 82, 97, 98, 99, 100, 101, 103, 104, 126, 127, 128, 129, 131, 132, 154, 155, 156, 157, 158, 159, 160
3D-footprint Homologues: 2kmk_A, 6wmi_A, 1tf3_A, 5k5i_A, 7w1m_H, 5und_A, 8ssu_A, 1tf6_A, 5v3j_F, 8gn3_A, 5ei9_F, 1mey_C, 8ssq_A, 2lt7_A, 2i13_A, 1ubd_C, 6jnm_A, 1f2i_J, 2gli_A, 6ml4_A, 4x9j_A, 6blw_A, 5kkq_D, 2wbs_A, 5kl3_A, 4m9v_C, 7eyi_G, 7ysf_A, 6e94_A, 6a57_A, 5yel_A, 2jpa_A, 8cuc_F, 7y3l_A, 1g2f_F, 1llm_D, 7txc_E, 7y3m_I, 7n5w_A, 3uk3_C, 5yj3_D, 5k5l_F, 6u9q_A, 8h9h_G, 2drp_D
Binding Motifs: CG31670_SANGER_5_FBgn0031375 AAAwGmgCAwC
CG31670_SOLEXA_5_FBgn0031375 ymAAAwGAGCAAycv
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.