Transcription Factor
| Accessions: | 1akh_A (3D-footprint 20231221) |
| Names: | MATa1 protein, MATA1_YEASX, MATING-TYPE PROTEIN A-1, Mating-type protein A1 |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0CY10 |
| Length: | 49 |
| Pfam Domains: | 2-48 Homeobox domain 22-48 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 ISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS |
| Interface Residues: | 36, 37, 39, 40, 43, 44, 47, 48 |
| 3D-footprint Homologues: | 3wgi_D, 5jlw_D, 1ig7_A, 1e3o_C, 4j19_B, 1au7_A, 1le8_A, 7q3o_C, 1zq3_P, 6es3_K, 4xrs_G, 3lnq_A, 1o4x_A, 8g87_X, 5zfz_A, 3cmy_A, 2h1k_B, 1jgg_B, 6fqp_B, 5flv_I, 3rkq_B, 2lkx_A, 1puf_A, 1fjl_B, 5zjt_E, 4qtr_D, 3d1n_M, 6fqq_E, 1b72_A, 5hod_A, 2r5y_A, 1puf_B, 6a8r_A, 4xrm_B, 3l1p_A, 2hdd_A, 1nk2_P, 1du0_A, 4cyc_A, 3a01_E, 2hos_A, 1ic8_B, 2h8r_B |
| Binding Motifs: | 1akh_A TnTnTCA 1akh_AB TGAnAnAnnnTTTTACA |
| Binding Sites: | 1akh_C 1akh_D |
| Publications: | Li T, Jin Y, Vershon A.K, Wolberger C. Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract. Nucleic acids research 26:5707-18 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.