Transcription Factor
Accessions: | ECK120004493 (RegulonDB 7.5) |
Names: | CpxR, CpxR transcriptional dual regulator |
Organisms: | ECK12 |
Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
Notes: | specific transcriptional repressor activity; negative regulation of transcription, DNA-dependent; sequence-specific DNA binding transcription factor activity; cytoplasm; two-component signal transduction system (phosphorelay); two-component response regulator activity; transcription activator activity; proteins/peptides/glycopeptides; detoxification; Transcription related; two component regulatory systems (external signal); repressor; activator; intracellular signal transduction; positive regulation of transcription, DNA-dependent |
Length: | 233 |
Pfam Domains: | 4-112 Response regulator receiver domain 152-228 Transcriptional regulatory protein, C terminal |
Sequence: (in bold interface residues) | 1 MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGI 60 61 DTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHW 120 121 SEQQQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREH 180 181 LSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS* |
Interface Residues: | 194, 195, 196, 198, 199, 200, 202, 203, 222 |
3D-footprint Homologues: | 8jo2_H, 5x5l_H, 8hih_Q, 4kfc_B, 6lxn_A, 8hml_B, 4nhj_A, 7e1b_B, 5ed4_A, 2z33_A, 8b4b_W |
Binding Motifs: | CpxR GTAAArmwrygwaAr |
Binding Sites: | ECK120011212 ECK120011214 ECK120011216 ECK120011218 ECK120011322 ECK120012502 ECK120012504 ECK120012506 ECK120015590 ECK120016114 ECK120016116 ECK120016120 ECK120016123 ECK120016186 ECK120016233 ECK120016235 ECK120016237 ECK120016239 ECK120016241 ECK120016458 ECK120016460 ECK120016462 ECK120016464 ECK120016466 ECK120016468 ECK120016470 ECK120016801 ECK120016885 ECK120016892 ECK120016894 ECK120016896 ECK120017106 ECK120017107 ECK120017108 ECK120019268 ECK120029639 ECK120029870 ECK120029872 ECK120029874 ECK120029876 ECK120029878 ECK120029880 ECK120029882 ECK120029884 ECK120029886 ECK125110219 ECK125110221 ECK125110223 ECK125110225 ECK125110227 ECK125110229 ECK125110231 ECK125110233 ECK125110235 ECK125141167 ECK125141169 ECK125141171 ECK125141173 ECK125141175 ECK125141177 ECK125141179 ECK125141181 ECK125141183 |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.