Transcription Factor

Accessions: T030355_1.02 (CISBP 1.02)
Names: 1500010105, T030355_1.02;
Organisms: Ostreococcus tauri
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:bZIP
Length: 193
Pfam Domains: 137-189 bZIP transcription factor
142-190 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 MLSLPSLSTMSFRELTAALAEEGEKASEATTRGRRAATKKTKTTTKTKTSATISATTAVK 60
61 RSRNGVVKTRATPEAKMGRRTRMKIDTVAVPTVPGVSYAPMKLKRRSNIPTPAIRRALAP 120
121 KKMGRRPKDAPEETAEEKTLRAQERLFRNRESAARSREKRLGALRALEDENAQLKGELTR 180
181 LKNKLAKYERANP
Interface Residues: 145, 149, 150, 152, 153, 156, 157
3D-footprint Homologues: 2wt7_B, 4eot_A, 2dgc_A, 1t2k_D
Binding Motifs: M0364_1.02 wyGCCACGTG
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.