Transcription Factor
| Accessions: | Atoh1_DBD (HumanTF 1.0), T015240_1.02 (CISBP 1.02), ATOH1_MOUSE (HOCOMOCO 10), P48985 (JASPAR 2024) |
| Names: | Atoh1, ATOH1_MOUSE, Helix-loop-helix protein mATH-1, mATH1, Protein atonal homolog 1, T015240_1.02;, Atonal bHLH transcription factor 1, Transcription factor Atoh1 |
| Organisms: | Mus musculus |
| Libraries: | HumanTF 1.0 1, CISBP 1.02 2, HOCOMOCO 10 3, JASPAR 2024 4 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 4 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | Ensembl ID: ENSMUSG00000073043; DNA-binding domain sequence; TF family: bHLH; Clone source: Hughes lab., experiment type:PBM, family:bHLH |
| Length: | 351 |
| Pfam Domains: | 157-208 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPR 60 61 AWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVK 120 121 VREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLR 180 181 NVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASS 240 241 YEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALT 300 301 AMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS |
| Interface Residues: | 158, 160, 161, 162, 164, 165, 166, 168, 169, 192, 194 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 1an4_A, 5i50_B, 4h10_A, 6g1l_A, 6od3_F, 7ssa_L, 2ql2_A, 2ql2_D, 8osl_P, 5eyo_A, 2ypa_B, 5gnj_I |
| Binding Motifs: | Atoh1_DBD / MA0461.2 rmCATATGky MA0461.1 CAGmTGGy M0224_1.02 rmCATATGtt ATOH1_MOUSE.H10MO.C|M01017 rrCAGmTGGya MA1467.2 rvCAGATGGym MA0461.3 rmCATATG MA1467.3 CAGATGG |
| Binding Sites: | MA0461.1.1 MA0461.1.10 MA0461.1.11 MA0461.1.12 MA0461.1.13 MA0461.1.14 MA0461.1.15 MA0461.1.16 MA0461.1.17 MA0461.1.18 MA0461.1.19 MA0461.1.2 MA0461.1.20 MA0461.1.3 MA0461.1.4 MA0461.1.5 MA0461.1.6 MA0461.1.7 MA0461.1.8 MA0461.1.9 MA1467.2.1 MA1467.2.10 / MA1467.2.7 MA1467.2.11 / MA1467.2.8 MA1467.2.12 / MA1467.2.9 MA1467.2.10 / MA1467.2.13 MA1467.2.11 / MA1467.2.14 / MA1467.2.18 MA1467.2.12 / MA1467.2.15 MA1467.2.13 / MA1467.2.16 MA1467.2.14 / MA1467.2.17 MA1467.2.15 / MA1467.2.18 MA1467.2.16 / MA1467.2.19 MA1467.2.2 MA1467.2.17 / MA1467.2.20 MA1467.2.3 MA1467.2.4 MA1467.2.4 / MA1467.2.5 MA1467.2.5 / MA1467.2.6 MA1467.2.7 MA1467.2.6 / MA1467.2.8 MA1467.2.9 MA1467.2.19 MA1467.2.20 MA1467.3.1 / MA1467.3.10 / MA1467.3.11 / MA1467.3.12 / MA1467.3.14 / MA1467.3.15 / MA1467.3.16 / MA1467.3.17 / MA1467.3.2 / MA1467.3.20 / MA1467.3.5 / MA1467.3.6 / MA1467.3.8 MA1467.3.13 / MA1467.3.18 / MA1467.3.3 MA1467.3.19 MA1467.3.4 MA1467.3.7 MA1467.3.9 |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Lai H.C, Klisch T.J, Roberts R, Zoghbi H.Y, Johnson J.E. In vivo neuronal subtype-specific targets of Atoh1 (Math1) in dorsal spinal cord. The Journal of neuroscience : the official journal of the Society for Neuroscience 31:10859-71 (2011). [Pubmed] Klisch TJ, Xi Y, Flora A, Wang L, Li W, Zoghbi HY. In vivo Atoh1 targetome reveals how a proneural transcription factor regulates cerebellar development. Proc Natl Acad Sci U S A 108:3288-93 (2011). [Pubmed] Masuda M, Pak K, Chavez E, Ryan AF. TFE2 and GATA3 enhance induction of POU4F3 and myosin VIIa positive cells in nonsensory cochlear epithelium by ATOH1. Dev Biol 372:68-80 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.