Transcription Factor

Accessions: T016860_1.02 (CISBP 1.02), Q19917 (JASPAR 2020)
Names: hlh-29, T016860_1.02;, Q19917_CAEEL
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1, JASPAR 2020 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Uniprot: Q19917
Notes: experiment type:PBM, family:bHLH
Length: 239
Pfam Domains: 24-67 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MPKVHQATFPKASVHSVPYNQTRKSVSERKRRDEINELLENLKTIVQNPSDSNEKISHET 60
61 ILFRVFERVSGVDLETKFNSTVDIPKAEGNTKEEKQKVKTKREQIRRSKQDICYTELGNF 120
121 VHKNRLGNTEQRNKLERVTVLQIILEYICQMPEQSEAIEKENSPMYQVYLEPTKCISPEQ 180
181 SVASPSPFLLSNTLAFFNQVAQLHFIAKLQAMLPPTPVQTPEAHMKEQTNEEEDIDIIG
Interface Residues: 28, 29, 31, 32
3D-footprint Homologues: 5nj8_C, 1an4_A, 4h10_A, 6g1l_A, 1hlo_B, 4h10_B, 1nkp_E, 5gnj_I, 4ejy_A
Binding Motifs: PL0008.1 cwrhyACGCrTGkyhwa
M0226_1.02 mCAyGCGT
Publications: Grove C.A, De Masi F, Barrasa M.I, Newburger D.E, Alkema M.J, Bulyk M.L, Walhout A.J. A multiparameter network reveals extensive divergence between C. elegans bHLH transcription factors. Cell 138:314-27 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.