Transcription Factor
| Accessions: | EVX1_DBD (HumanTF 1.0), EVX1_TF1 (HumanTF2 1.0), EVX1_TF2 (HumanTF2 1.0), EVX1 (HT-SELEX2 May2017) |
| Names: | EVX-1, EVX1, EVX1_HUMAN, Homeobox even-skipped homolog protein 1, ENSG00000106038 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P49640 |
| Notes: | Ensembl ID: ENSG00000106038; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, Ensembl ID: ENSG00000106038; Construct type: TF1(SBP); TF family: Homeodomain; Clone source: Jolma et al. 2013, Ensembl ID: ENSG00000106038; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 132 |
| Pfam Domains: | 43-99 Homeobox domain |
| Sequence: (in bold interface residues) | 1 KGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTREQIARLEKE 60 61 FYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMS 120 121 HAAAAGGLPYPF |
| Interface Residues: | 43, 44, 45, 46, 84, 85, 87, 88, 91, 92, 95, 96, 99 |
| 3D-footprint Homologues: | 1puf_A, 1ig7_A, 3cmy_A, 5zfz_A, 3d1n_M, 1fjl_B, 6a8r_A, 2h1k_B, 2lkx_A, 1jgg_B, 6m3d_C, 1nk2_P, 1zq3_P, 3lnq_A, 6es3_K, 2ld5_A, 7q3o_C, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 1puf_B, 5flv_I, 2hos_A, 5zjt_E, 4cyc_A, 7psx_B, 5hod_A, 3l1p_A, 3a01_E, 1b72_A, 5jlw_D, 7xrc_C, 1e3o_C, 2xsd_C, 1au7_A, 1le8_A, 1mnm_C, 1du0_A, 8g87_X, 1k61_B, 1o4x_A, 4qtr_D |
| Binding Motifs: | EVX1_DBD gvtaATTAsc CLOCK_EVX1_1 rTaATyayygmCACGTG CLOCK_EVX1_2 CACGTGysGTAATgAT CLOCK_EVX1_2_3 trATwAtyrmcrMACGTG CLOCK_EVX1_2_3_4 yrATwAttsmkkaCAyGTG ELK1_EVX1 rsCGGwAATgrymATTA ETV2_EVX1 asCGGwAATkrymrTTwm ETV5_EVX1_1 rsCGGWAATkr- ETV5_EVX1_2 rsCGGwAATgvbsaTtAr ETV5_EVX1_2_3 rsmGGWAATgrgyvaTtAk MEIS1_EVX1 TGACAtcTAATcATTA MGA_EVX1_1 rGGTGwTAATkw MGA_EVX1_2 rGGTGwTAATkwasrTTA EVX1_3 sTaATTAs EVX1_methyl_1 sTaATtAs EVX1_methyl_2 vTCrTtAk |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.