Transcription Factor
| Accessions: | ECK120004910 (RegulonDB 7.5) |
| Names: | IHF, integration host factor (IHF), &beta, subunit |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The protein family is HI-HN-S; conjugation; cytoplasm; DNA recombination; transcription, DNA-dependent; transcription repressor activity; transcription activator activity; DNA binding; activator; Transcription related; repressor; nucleoproteins, basic proteins; regulation of translation; regulation of transcription, DNA-dependent; chromosome |
| Length: | 95 |
| Pfam Domains: | 1-91 Bacterial DNA-binding protein |
| Sequence: (in bold interface residues) | 1 MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRT 60 61 GRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG* |
| Interface Residues: | 5, 8, 9, 16, 38, 44, 46, 59, 62, 63, 64, 65, 72 |
| 3D-footprint Homologues: | 1efa_B, 4qju_B, 1owf_B, 2iie_A, 2np2_A, 1p71_B, 1owf_A |
| Binding Motifs: | IHF TAAytaatTGwWw |
| Binding Sites: | ECK120011226 ECK120011255 ECK120011257 ECK120011259 ECK120011261 ECK120011263 ECK120011398 ECK120011455 ECK120011519 ECK120011537 ECK120011555 ECK120011557 ECK120011559 ECK120011561 ECK120011570 ECK120011618 ECK120011653 ECK120011662 ECK120011768 ECK120011779 ECK120011781 ECK120011806 ECK120011870 ECK120012139 ECK120012233 ECK120012271 ECK120012273 ECK120012282 ECK120012390 ECK120012431 ECK120012456 ECK120012458 ECK120012810 ECK120012838 ECK120012840 ECK120012842 ECK120013149 ECK120013151 ECK120013153 ECK120013155 ECK120013157 ECK120013159 ECK120013161 ECK120013266 ECK120013312 ECK120013336 ECK120013359 ECK120013361 ECK120013433 ECK120013476 ECK120013505 ECK120013531 ECK120013533 ECK120013535 ECK120013661 ECK120013663 ECK120013733 ECK120013735 ECK120013737 ECK120013754 ECK120013824 ECK120013874 ECK120013876 ECK120013878 ECK120013880 ECK120013934 ECK120013936 ECK120013982 ECK120013985 ECK120014041 ECK120014077 ECK120014097 ECK120014099 ECK120014101 ECK120015219 ECK120015221 ECK120016016 ECK120017136 ECK120020712 ECK120023299 ECK120026323 ECK120029476 ECK120029479 ECK120029480 ECK120029890 ECK120029981 ECK120029983 ECK120029985 ECK120029987 ECK120033051 ECK120033090 ECK120033092 ECK120033101 ECK120033214 ECK125108635 ECK125110237 ECK125110239 ECK125134914 |
| Publications: | Yang CC., Nash HA. The interaction of E. coli IHF protein with its specific binding sites. Cell. 57(5):869-80 (1989). [Pubmed] Rice PA., Yang S., Mizuuchi K., Nash HA. Crystal structure of an IHF-DNA complex: a protein-induced DNA U-turn. Cell. 87(7):1295-306 (1996). [Pubmed] Friedman DI. Integration host factor: a protein for all reasons. Cell. 55(4):545-54 (1988). [Pubmed] Goodrich JA., Schwartz ML., McClure WR. Searching for and predicting the activity of sites for DNA binding proteins: compilation and analysis of the binding sites for Escherichia coli integration host factor (IHF). Nucleic Acids Res. 18(17):4993-5000 (1990). [Pubmed] Ellenberger T., Landy A. A good turn for DNA: the structure of integration host factor bound to DNA. Structure. 5(2):153-7 (1997). [Pubmed] Nash HA., Robertson CA., Flamm E., Weisberg RA., Miller HI. Overproduction of Escherichia coli integration host factor, a protein with nonidentical subunits. J Bacteriol. 169(9):4124-7 (1987). [Pubmed] Sarkar T., Petrov AS., Vitko JR., Santai CT., Harvey SC., Mukerji I., Hud NV. Integration host factor (IHF) dictates the structure of polyamine-DNA condensates: implications for the role of IHF in the compaction of bacterial chromatin. Biochemistry. 48(4):667-75 (2009). [Pubmed] Santero E., Hoover TR., North AK., Berger DK., Porter SC., Kustu S. Role of integration host factor in stimulating transcription from the sigma 54-dependent nifH promoter. J Mol Biol. 227(3):602-20 (1992). [Pubmed] Hoover TR., Santero E., Porter S., Kustu S. The integration host factor stimulates interaction of RNA polymerase with NIFA, the transcriptional activator for nitrogen fixation operons. Cell. 63(1):11-22 (1990). [Pubmed] Moitoso de Vargas L., Kim S., Landy A. DNA looping generated by DNA bending protein IHF and the two domains of lambda integrase. Science. 244(4911):1457-61 (1989). [Pubmed] Miller HI., Friedman DI. An E. coli gene product required for lambda site-specific recombination. Cell. 20(3):711-9 (1980). [Pubmed] Ali Azam T., Iwata A., Nishimura A., Ueda S., Ishihama A. Growth phase-dependent variation in protein composition of the Escherichia coli nucleoid. J Bacteriol. 181(20):6361-70 (1999). [Pubmed] Dhavan GM., Crothers DM., Chance MR., Brenowitz M. Concerted binding and bending of DNA by Escherichia coli integration host factor. J Mol Biol. 315(5):1027-37 (2002). [Pubmed] Freundlich M., Ramani N., Mathew E., Sirko A., Tsui P. The role of integration host factor in gene expression in Escherichia coli. Mol Microbiol. 6(18):2557-63 (1992). [Pubmed] Swinger KK., Rice PA. IHF and HU: flexible architects of bent DNA. Curr Opin Struct Biol. 14(1):28-35 (2004). [Pubmed] Hales LM., Gumport RI., Gardner JF. Examining the contribution of a dA+dT element to the conformation of Escherichia coli integration host factor-DNA complexes. Nucleic Acids Res. 24(9):1780-6 (1996). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.