Transcription Factor

Accessions: CG4360-F1-3 (FlyZincFinger 1.0 )
Names: CG4360
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 108
Pfam Domains: 13-36 C2H2 type zinc-finger (2 copies)
16-37 C2H2-type zinc finger
16-37 Zinc finger, C2H2 type
16-35 C2H2-type zinc finger
30-53 Zinc-finger double domain
42-61 C2H2-type zinc finger
43-65 C2H2-type zinc finger
43-65 Zinc finger, C2H2 type
58-81 Zinc-finger double domain
70-94 C2H2-type zinc finger
71-93 C2H2-type zinc finger
71-93 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 ISEEEVVVDDPRKKKQCHVCKNKFRQLTTLRNHMKIHTDERPYKCKHCDKAFRQISTLTN 60
61 HVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQ
Interface Residues: 25, 26, 27, 28, 29, 31, 32, 34, 35, 38, 53, 54, 55, 56, 57, 59, 60, 61, 68, 81, 82, 83, 84, 85, 86, 87, 88, 89, 92
3D-footprint Homologues: 7w1m_H, 6jnm_A, 7n5w_A, 1tf3_A, 2kmk_A, 1tf6_A, 5und_A, 2gli_A, 7eyi_G, 1ubd_C, 4x9j_A, 2i13_A, 1mey_C, 6blw_A, 5kkq_D, 6u9q_A, 5ei9_F, 5kl3_A, 7ysf_A, 1g2f_F, 6wmi_A, 5v3j_F, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 5k5i_A, 8ssq_A, 1llm_D, 5k5l_F, 6ml4_A, 8gn3_A, 2wbs_A, 1f2i_J, 5yel_A, 7txc_E, 2drp_D, 4m9v_C, 7y3m_I, 1yuj_A, 5yj3_D
Binding Motifs: CG4360-F1-3_SOLEXA_FBgn0038787 ktTGTTGTTGTwrtt
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.