Transcription Factor

Accessions: MEF2A_HUMAN (HOCOMOCO 10), EAX02249 (JASPAR 2018), Q02078 (JASPAR 2018)
Names: MEF2A_HUMAN, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1, A0A0S2Z453_HUMAN, Fragment, MADS box transcription enhancer factor 2, polypeptide A, Myocyte enhancer factor 2A, Myocyte enhancer factor 2A isoform 2
Organisms: Homo sapiens
Libraries: HOCOMOCO 10 1, JASPAR 2018 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
2 [Pubmed]
Length: 507
Pfam Domains: 10-59 SRF-type transcription factor (DNA-binding and dimerisation domain)
90-154 Holliday junction regulator protein family C-terminal repeat
Sequence:
(in bold interface residues)
1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST 60
61 DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE 120
121 EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSML 180
181 SPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIG 240
241 ATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQR 300
301 ISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLS 360
361 LGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ 420
421 QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSP 480
481 IVLGRPPNTEDRESPSVKRMRMDAWVT
Interface Residues: 3, 4, 15, 18, 19, 23
3D-footprint Homologues: 1egw_B, 1hbx_D, 1n6j_A, 1mnm_A
Binding Motifs: MA0052.3 kCTAwAAATAGm
MA0052.2 dkCyAAAAATAGmhy
MEF2A_HUMAN.H10MO.A|M01319 dkCTATTTTTrGm
MA0052.1 CTATTTwTAG
Binding Sites: MA0052.1.1
MA0052.1.10
MA0052.1.11
MA0052.1.12
MA0052.1.13
MA0052.1.14
MA0052.1.15
MA0052.1.16
MA0052.1.17
MA0052.1.18
MA0052.1.19
MA0052.1.2
MA0052.1.20
MA0052.1.3
MA0052.1.4
MA0052.1.5
MA0052.1.6
MA0052.1.7
MA0052.1.8
MA0052.1.9
MA0052.2.1
MA0052.2.10
MA0052.2.11
MA0052.2.12
MA0052.2.13
MA0052.2.14
MA0052.2.15
MA0052.2.16
MA0052.2.17
MA0052.2.18
MA0052.2.19
MA0052.2.2
MA0052.2.20
MA0052.2.3
MA0052.2.4
MA0052.2.5
MA0052.2.6
MA0052.2.7
MA0052.2.8
MA0052.2.9
Publications: Pollock R., Treisman R. Human SRF-related proteins: DNA-binding properties and potential regulatory targets. Genes Dev. 5:2327-2341 (1991). [Pubmed]

Wales S, Hashemi S, Blais A, McDermott JC. Global MEF2 target gene analysis in cardiac and skeletal muscle reveals novel regulation of DUSP6 by p38MAPK-MEF2 signaling. Nucleic Acids Res 42:11349-62 (2014). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.