Transcription Factor
Accessions: | ALX4_DBD (HumanTF 1.0), ALX4_TF2 (HumanTF2 1.0) |
Names: | ALX4, ALX4_HUMAN |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Uniprot: | Q9H161 |
Notes: | Ensembl ID: ENSG00000052850; DNA-binding domain sequence; TF family: homeodomain; Clone source: Megaman, Ensembl ID: ENSG00000052850; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013 |
Length: | 135 |
Pfam Domains: | 47-103 Homeobox domain |
Sequence: (in bold interface residues) | 1 MADTVGMDSSYLSVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEE 60 61 LEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTA 120 121 YELPLLTRAENYAQI |
Interface Residues: | 46, 47, 48, 49, 50, 88, 89, 91, 92, 95, 96, 99, 100, 103 |
3D-footprint Homologues: | 4j19_B, 1fjl_B, 6a8r_A, 3d1n_M, 1ig7_A, 5zfz_A, 2h1k_B, 1puf_A, 3cmy_A, 1nk2_P, 1zq3_P, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 2ld5_A, 1puf_B, 2hos_A, 7q3o_C, 1b72_A, 5jlw_D, 4cyc_A, 6es3_K, 4xrs_G, 3l1p_A, 3a01_E, 5flv_I, 5zjt_E, 2hdd_A, 7psx_B, 1au7_A, 5hod_A, 3rkq_B, 2r5y_A, 2xsd_C, 7xrc_C, 1e3o_C, 1le8_A, 4xrm_B, 1o4x_A, 1du0_A, 8g87_X, 4qtr_D |
Binding Motifs: | ALX4_DBD mTAATyhaATTAm ALX4_EOMES skyGctAAytwwwktTvrCACmt ALX4_TBX21_1 rgGTGykAATwawmrtysrCAsykm ALX4_TBX21_2 AGGTGytAATwa TEAD4_ALX4_1 GGAATGytAamytAATTa TEAD4_ALX4_2 rCATwcCkyshTAATyrrATTA |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.