Transcription Factor
| Accessions: | NEUROD1 (HT-SELEX2 May2017), NDF1_HUMAN (HOCOMOCO 10), Q13562 (JASPAR 2024) |
| Names: | ENSG00000162992, NEUROD1, bHLHa3, Class A basic helix-loop-helix protein 3, NDF1_HUMAN, NeuroD, Neurogenic differentiation factor 1 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q13562 |
| Notes: | TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 356 |
| Pfam Domains: | 102-153 Helix-loop-helix DNA-binding domain 160-284 Neuronal helix-loop-helix transcription factor |
| Sequence: (in bold interface residues) | 1 MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEEDSLRNGGEEE 60 61 DEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA 120 121 LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT 180 181 TNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF 240 241 HVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT 300 301 MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD |
| Interface Residues: | 103, 106, 107, 109, 110, 111, 113, 114 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 6od3_F, 2ql2_A, 2ql2_D, 2ypa_B |
| Binding Motifs: | NEUROD1_2 AAwTAssgyrmCATATGky NEUROD1_methyl_1 AAwTAvsgyrmCATATGby NDF1_HUMAN.H10MO.C|M01351 crrCAGrTGkcc MA1109.1 graCAGATGGyrs MA1109.2 aCAGATGG |
| Binding Sites: | MA1109.2.1 MA1109.2.13 MA1109.2.9 MA1109.2.18 / MA1109.2.7 / MA1109.2.8 MA1109.2.10 / MA1109.2.12 / MA1109.2.14 / MA1109.2.16 / MA1109.2.3 MA1109.1.1 MA1109.1.10 MA1109.1.11 MA1109.1.12 MA1109.1.13 MA1109.1.14 MA1109.1.15 MA1109.1.16 MA1109.1.17 MA1109.1.18 MA1109.1.19 MA1109.1.2 MA1109.1.20 MA1109.1.3 MA1109.1.4 MA1109.1.5 MA1109.1.6 MA1109.1.7 MA1109.1.8 MA1109.1.9 MA1109.2.11 / MA1109.2.4 MA1109.2.15 / MA1109.2.19 / MA1109.2.2 / MA1109.2.5 / MA1109.2.6 MA1109.2.17 / MA1109.2.20 |
| Publications: | Sharma A, Moore M, Marcora E, Lee JE, Qiu Y, Samaras S, Stein R. The NeuroD1/BETA2 sequences essential for insulin gene transcription colocalize with those necessary for neurogenesis and p300/CREB binding protein binding. Mol Cell Biol 19:704-13 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.