Transcription Factor
| Accessions: | ECK120006852 (RegulonDB 7.5) |
| Names: | ExuR, ExuR DNA-binding transcriptional repressor |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The Exuronate repressor,ExuR, is a DNA-binding transcription factor that negatively regulates its own synthesis and represses transcription of the operons involved in transport and catabolism of galacturonate and glucuronate Hugovieux-Cotte-Pattat N,1982; Rodionov DA,2000; Ritzenthaler P,1981; Robert-Baudouy J,1981; Hugouvieux-Cotte-Pattat N,1981; Nemoz G,1976; On the other hand, ExuR is similar to UxuR ARRAY(0x245a4c0) , and apparently both act together and are capable of cross-talk to regulate expression of the uxu operon Rodionov DA,2000; Ritzenthaler P,1983; Ritzenthaler P,1985 ; For this reason, there is the possibility that these regulators bind the same sites with different affinities; Currently, no DNA-binding sites for this regulator have been reported in the literature, and although little is known about the regulating mechanism of ExuR, it has been shown to act as a repressor that binds to a putative inverted repeat sequence Rodionov DA,2000 ; Comparative analysis of intergenic DNA sequences showed the consistent occurrence of ExuR possible binding sites upstream of the genes related to the transport of gluconate ARRAY(0x245cc80) and with the transport and degradation of glucuronides ARRAY(0x24335f8) Rodionov DA,2000 ."; carbon compounds; repressor; regulon; Transcription related; cytoplasm; regulation of transcription, DNA-dependent; sequence-specific DNA binding transcription factor activity; DNA binding; carbohydrate catabolic process; transcription, DNA-dependent; transcription repressor activity; intracellular |
| Length: | 259 |
| Pfam Domains: | 9-72 Bacterial regulatory proteins, gntR family 96-220 FCD domain |
| Sequence: (in bold interface residues) | 1 MEITEPRRLYQQLAADLKERIEQGVYLVGDKLPAERFIADEKNVSRTVVREAIIMLEVEG 60 61 YVEVRKGSGIHVVSNQPRHQQAADNNMEFANYGPFELLQARQLIESNIAEFAATQVTKQD 120 121 IMKLMAIQEQARGEQCFRDSEWDLQFHIQVALATQNSALAAIVEKMWTQRSHNPYWKKLH 180 181 EHIDSRTVDNWCDDHDQILKALIRKDPHAAKLAMWQHLENTKIMLFNETSDDFEFNADRY 240 241 LFAENPVVHLDTATSGSK* |
| Interface Residues: | 10, 34, 35, 36, 39, 45, 46, 47, 48, 49, 50, 51, 66, 67 |
| 3D-footprint Homologues: | 7b5y_B, 7zla_B, 6wg7_G, 4wwc_B, 4h0e_A, 4p9u_F, 6za3_B, 4u0y_B, 1h9t_B |
| Binding Motifs: | ExuR AAAgTgGTwdAmCAmaT |
| Binding Sites: | ECK120018520 ECK120048930 ECK120049006 ECK125134896 |
| Publications: | Rodionov DA., Mironov AA., Rakhmaninova AB., Gelfand MS. Transcriptional regulation of transport and utilization systems for hexuronides, hexuronates and hexonates in gamma purple bacteria. Mol Microbiol. 38(4):673-83 (2000). [Pubmed] Ritzenthaler P., Blanco C., Mata-Gilsinger M. Interchangeability of repressors for the control of the uxu and uid operons in E. coli K12. Mol Gen Genet. 191(2):263-70 (1983). [Pubmed] Ritzenthaler P., Blanco C., Mata-Gilsinger M. Genetic analysis of uxuR and exuR genes: evidence for ExuR and UxuR monomer repressors interactions. Mol Gen Genet. 199(3):507-11 (1985). [Pubmed] Hugovieux-Cotte-Pattat N., Robert-Baudouy J. Regulation and transcription direction of exuR, a self-regulated repressor in escherichia coli K-12. J Mol Biol. 156(1):221-8 (1982). [Pubmed] Ritzenthaler P., Mata-Gilsinger M., Stoeber F. Molecular cloning of Escherichia coli K-12 hexuronate system genes: exu region. J Bacteriol. 145(1):181-90 (1981). [Pubmed] Robert-Baudouy J., Portalier R., Stoeber F. Regulation of hexuronate system genes in Escherichia coli K-12: multiple regulation of the uxu operon by exuR and uxuR gene products. J Bacteriol. 145(1):211-20 (1981). [Pubmed] Hugouvieux-Cotte-Pattat N., Robert-Baudouy J. Isolation of fusions between the lac genes and several genes of the exu regulon: analysis of their regulation, determination of the transcription direction of the uxaC-uxaA operon, in Escherichia coli K-12. Mol Gen Genet. 182(2):279-87 (1981). [Pubmed] Nemoz G., Robert-Baudouy J., Stoeber F. Physiological and genetic regulation of the aldohexuronate transport system in Escherichia coli. J Bacteriol. 127(2):706-18 (1976). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.