Transcription Factor
| Accessions: | HNF4A_HUMAN (HOCOMOCO 10), P41235 (JASPAR 2024) |
| Names: | Hepatocyte nuclear factor 4-alpha, HNF-4-alpha, HNF4A_HUMAN, Nuclear receptor subfamily 2 group A member 1, TCF-14, Transcription factor 14, Transcription factor HNF-4 |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P41235 |
| Length: | 474 |
| Pfam Domains: | 59-127 Zinc finger, C4 type (two domains) 175-361 Ligand-binding domain of nuclear hormone receptor |
| Sequence: (in bold interface residues) | 1 MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC 60 61 AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC 120 121 FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK 180 181 IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK 240 241 DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK 300 301 GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL 360 361 FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW 420 421 PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI |
| Interface Residues: | 68, 69, 71, 72, 78, 79, 81, 82, 85, 86, 110, 132, 134, 136, 138, 139, 141, 143 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B |
| Binding Motifs: | MA0114.1 rGgbCAAAGkyCa MA0114.2 cTGrmCTTTGrmCyy MA1494.1 rrGTCCAAAGGTCRm HNF4A_HUMAN.H10MO.A|M01225 rrGkyCAAAGTyCA MA0114.4 kyCAAAGTCCArr MA0114.5 CAAAGTCCA MA1494.2 rrGTCCAAAGGTCR |
| Binding Sites: | MA0114.1.1 MA0114.1.10 MA0114.1.11 MA0114.1.12 MA0114.1.13 MA0114.1.14 MA0114.1.15 MA0114.1.16 MA0114.1.17 MA0114.1.18 MA0114.1.19 MA0114.1.2 MA0114.1.20 MA0114.1.3 MA0114.1.4 MA0114.1.5 MA0114.1.6 MA0114.1.7 MA0114.1.8 MA0114.1.9 MA0114.2.1 MA0114.2.10 MA0114.2.11 MA0114.2.12 MA0114.2.13 MA0114.2.14 MA0114.2.15 MA0114.2.16 MA0114.2.17 MA0114.2.18 MA0114.2.19 MA0114.2.2 MA0114.2.20 MA0114.2.3 MA0114.2.4 MA0114.2.5 MA0114.2.6 MA0114.2.7 MA0114.2.8 MA0114.2.9 MA0114.4.1 MA0114.4.10 MA0114.4.11 MA0114.4.12 / MA0114.4.8 MA0114.4.13 / MA0114.4.9 MA0114.4.10 / MA0114.4.14 MA0114.4.15 MA0114.4.11 / MA0114.4.16 MA0114.4.12 / MA0114.4.17 MA0114.4.18 MA0114.4.13 / MA0114.4.19 MA0114.4.2 MA0114.4.14 / MA0114.4.20 MA0114.4.3 MA0114.4.4 MA0114.4.5 MA0114.4.5 / MA0114.4.6 MA0114.4.6 / MA0114.4.7 MA0114.4.8 MA0114.4.7 / MA0114.4.9 MA0114.4.17 MA0114.4.18 MA0114.4.20 MA0114.4.15 MA0114.4.16 MA0114.4.19 MA0114.5.1 MA0114.5.10 MA0114.5.11 / MA0114.5.8 MA0114.5.12 / MA0114.5.2 MA0114.5.13 MA0114.5.14 / MA0114.5.17 MA0114.5.15 MA0114.5.16 / MA0114.5.18 MA0114.5.19 / MA0114.5.3 MA0114.5.20 MA0114.5.4 MA0114.5.5 MA0114.5.6 MA0114.5.7 MA0114.5.9 |
| Publications: | Ellrott K, Yang C, Sladek F.M, Jiang T. Identifying transcription factor binding sites through Markov chain optimization. Bioinformatics (Oxford, England) 18 Suppl 2:S100-9 (2002). [Pubmed] Fang B, Mane-Padros D, Bolotin E, Jiang T, Sladek F.M. Identification of a binding motif specific to HNF4 by comparative analysis of multiple nuclear receptors. Nucleic acids research 40:5343-56 (2012). [Pubmed] Boyle AP, Araya CL, Brdlik C, Cayting P, Cheng C, Cheng Y, Gardner K, Hillier LW, Janette J, Jiang L, Kasper D, Kawli T, Kheradpour P, Kundaje A, Li JJ, Ma L, Niu W, Rehm EJ, Rozowsky J, Slattery M, Spokony R, Terrell R, Vafeados D, Wang D, Weisdepp P, Wu YC, Xie D, Yan KK, Feingold EA, Good PJ, Pazin MJ, Huang H, Bickel PJ, Brenner SE, Reinke V, Waterston RH, Gerstein M, White KP, Kellis M, Snyder M. Comparative analysis of regulatory information and circuits across distant species. Nature 512:453-6 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.