Transcription Factor

Accessions: Q9VN10 (JASPAR 2024)
Names: Huckebein, Q9VN10_DROME, RE60512p
Organisms: Drosophila melanogaster
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 297
Pfam Domains: 195-217 C2H2-type zinc finger
195-217 Zinc finger, C2H2 type
210-236 Zinc-finger double domain
223-247 Zinc finger, C2H2 type
223-247 C2H2-type zinc finger
240-263 Zinc-finger double domain
253-275 Zinc finger, C2H2 type
253-275 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MSTINLHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASSSFGHDCDGDF 60
61 SSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATAS 120
121 LAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDA 180
181 QLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEEL 240
241 TRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYGY
Interface Residues: 178, 179, 180, 181, 184, 195, 205, 206, 207, 208, 209, 211, 212, 214, 215, 216, 218, 235, 236, 237, 238, 239, 241, 242, 243, 246, 263, 264, 265, 266, 267, 268, 269, 270, 271, 280
3D-footprint Homologues: 6ml4_A, 2i13_A, 2kmk_A, 1tf3_A, 6jnm_A, 7n5w_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 7eyi_G, 5k5l_F, 8ssu_A, 1tf6_A, 4x9j_A, 8gn3_A, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 5ei9_F, 1mey_C, 7ysf_A, 6wmi_A, 5k5i_A, 5v3j_F, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 1llm_D, 2wbs_A, 5yel_A, 7txc_E, 5kl3_A, 2drp_D, 1f2i_J, 4m9v_C, 5yj3_D
Binding Motifs: MA0450.1 kRGGCGTGA
Binding Sites: MA0450.1.1 / MA0450.1.10 / MA0450.1.11 / MA0450.1.12 / MA0450.1.2 / MA0450.1.3 / MA0450.1.4 / MA0450.1.5 / MA0450.1.6 / MA0450.1.7 / MA0450.1.8 / MA0450.1.9
MA0450.1.13 / MA0450.1.14 / MA0450.1.15
MA0450.1.16
MA0450.1.17 / MA0450.1.18 / MA0450.1.19 / MA0450.1.20
Publications: Noyes M.B, Meng X, Wakabayashi A, Sinha S, Brodsky M.H, Wolfe S.A. A systematic characterization of factors that regulate Drosophila segmentation via a bacterial one-hybrid system. Nucleic acids research 36:2547-60 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.