Transcription Factor

Accessions: 4wzs_D (3D-footprint 20210203)
Names: ECU04_1440 protein, Q8ST28_ENCCU, TFIID-1, TRANSCRIPTION INITIATION FACTOR TFIID
Organisms: Microsporidian parasite, Encephalitozoon cuniculi (strain GB-M1)
Libraries: 3D-footprint 20210203 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8ST28
Length: 178
Pfam Domains: 5-87 Transcription factor TFIID (or TATA-binding protein, TBP)
93-176 Transcription factor TFIID (or TATA-binding protein, TBP)
Sequence:
(in bold interface residues)
1 SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGK 60
61 MVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHS 120
121 NYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHR
Interface Residues: 9, 11, 39, 40, 54, 56, 62, 64, 98, 99, 101, 130, 131, 145, 147, 153, 155
3D-footprint Homologues: 1ais_A, 1qna_B, 1rm1_A, 1vto_B, 1ytb_A, 4roc_B, 4wzs_D, 5iyd_P, 6cnc_R
Binding Motifs: 4wzs_D CTTTTATAG
Binding Sites: 4wzs_E
4wzs_F
Publications: Butryn A, Schuller JM, Stoehr G, Runge-Wollmann P, Förster F, Auble DT, Hopfner KP. Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1. Elife : (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.