Transcription Factor
Accessions: | Q9SA07 (JASPAR 2024), T06837 (AthalianaCistrome v4_May2016) |
Names: | Agamous-like MADS-box protein AGL63, AGL63_ARATH, Protein GORDITA, AGL63, AT1G31140, T06837; |
Organisms: | Arabidopsis thaliana |
Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
Notes: | ecotype:Col-0, experiment type: DAP-seq, family:MADS |
Length: | 215 |
Pfam Domains: | 9-59 SRF-type transcription factor (DNA-binding and dimerisation domain) 89-157 K-box region |
Sequence: (in bold interface residues) | 1 MRKGKRVIKKIEEKIKRQVTFAKRKKSLIKKAYELSVLCDVHLGLIIFSHSNRLYDFCSN 60 61 STSMENLIMRYQKEKEGQTTAEHSFHSDQCSDCVKTKESMMREIENLKLNLQLYDGHGLN 120 121 LLTYDELLSFELHLESSLQHARARKSEFMHQQQQQQTDQKLKGKEKGQGSSWEQLMWQAE 180 181 RQMMTCQRQKDPAPANEGGVPFLRWGTTHRRSSPP |
Interface Residues: | 15, 18, 19, 23, 114, 135, 140 |
3D-footprint Homologues: | 1c7u_A, 1mnm_A, 1hbx_A, 1n6j_A, 7x1n_C, 7qxb_P |
Binding Motifs: | M0478 / MA1203.1 TkCCAAAAAtGGmAA |
Binding Sites: | MA1203.1.1 MA1203.1.10 MA1203.1.11 MA1203.1.12 MA1203.1.13 MA1203.1.14 MA1203.1.15 MA1203.1.16 MA1203.1.17 MA1203.1.18 MA1203.1.19 MA1203.1.2 MA1203.1.20 MA1203.1.3 MA1203.1.4 MA1203.1.5 MA1203.1.6 MA1203.1.7 MA1203.1.8 MA1203.1.9 |
Publications: | Tang W., Perry S. E. Binding site selection for the plant MADS domain protein AGL15: an in vitro and in vivo study.. J. Biol. Chem. 278:28154-28159 (2003). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.