Transcription Factor

						

			
Accessions: T140197_1.02 (CISBP 1.02), Q9JL60 (JASPAR 2024)

			
Names: Gmeb1, T140197_1.02;, Glucocorticoid modulatory element-binding protein 1, GMEB-1, GMEB1_MOUSE
Organisms: Mus musculus
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]

2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q9JL60
Notes: experiment type:PBM, family:SAND
Length: 562
Pfam Domains:    79-156 SAND domain
Sequence: MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGIYEAGSENSAAVVAVET
HSIHKIEEGIDASSIEGNEDMEIAYPITCGESKAVLLWKKFVCPGINVKCVKFNDQLISP
KHFVHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSA
RAPVPGQQTSVVQTPTSADGNITQIAISEESMEEAGLEWNSALTAAVTMATEEGIKKESE
EISEDTLMFWKGIADVGLMEEVVCNIQKEMEELLRGVQQRLIQAPFQVTDAAVLNNVANT
FGLMDAVKRVLDNRRKQVEQGEEQFLYTLADLERQLEEQKKQAQDPRLKSQTVQNVVLMP
VSTPKPPKRPRLQRPASTTVLSPSPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGS
SPVTVHTLPSGPQLFRYATVVSSAKSNSPDTVTIHPSSSLALLSSTSMQDGSSLGNMATM
VSPMELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDSEADDTEGKAVILETGLRTEEK
VVAEMEEHQHQVHNVEIVVLED
Binding Motifs: MA0615.1 / PB0027.1 smkkkkRCGYmmgayrs
PB0131.1 kgrkcrACGTygtymw
M1550_1.02 yktrCGtmr
MA0615.2 kRCGYm
			
Publications: Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.