Transcription Factor
| Accessions: | Q8NDX6 (JASPAR 2024) |
| Names: | OriLyt TD-element-binding protein 7, Zinc finger protein 740, ZN740_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q8NDX6 |
| Length: | 193 |
| Pfam Domains: | 101-123 Zinc finger, C2H2 type 101-123 C2H2-type zinc finger 115-138 Zinc-finger double domain 129-151 Zinc finger, C2H2 type 129-151 C2H2-type zinc finger 143-167 Zinc-finger double domain 157-178 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSD 60 61 KSRSRKDDDSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHI 120 121 LIHTGEKPFECDICDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQ 180 181 GCQSKTSDGQFSL |
| Interface Residues: | 101, 111, 112, 113, 114, 115, 117, 118, 120, 121, 124, 139, 140, 141, 142, 143, 145, 146, 147, 168, 169, 170, 171, 172, 173, 174, 175 |
| 3D-footprint Homologues: | 2kmk_A, 8cuc_F, 1tf3_A, 7y3l_A, 5v3j_F, 7n5w_A, 6jnm_A, 3uk3_C, 5k5i_A, 8ssu_A, 6ml4_A, 2gli_A, 8gn3_A, 1g2f_F, 5kkq_D, 1tf6_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 1ubd_C, 7ysf_A, 6wmi_A, 5ei9_F, 8ssq_A, 1mey_C, 7w1m_H, 5und_A, 7eyi_G, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 6blw_A, 2jpa_A, 2drp_D, 1f2i_J, 5yel_A, 1llm_D, 7txc_E, 2wbs_A, 5yj3_D, 4m9v_C |
| Binding Motifs: | MA0753.1 mCCCCCCCAc MA0753.2 cyrCCCCCCCCAc MA0753.3 CCCCCCCCAc |
| Publications: | Weirauch MT, Cote A, Norel R, Annala M, Zhao Y, Riley TR, Saez-Rodriguez J, Cokelaer T, Vedenko A, Talukder S; DREAM5 Consortium, Bussemaker HJ, Morris QD, Bulyk ML, Stolovitzky G, Hughes TR. Evaluation of methods for modeling transcription factor sequence specificity. Nat Biotechnol 31:126-34 (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.