Transcription Factor
| Accessions: | Q9M1U4 (JASPAR 2024), T14484 (AthalianaCistrome v4_May2016) |
| Names: | TCP16_ARATH, AT3G45150, T14484;, TCP16 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Uniprot: | Q9M1U4 |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:TCP |
| Length: | 165 |
| Pfam Domains: | 12-141 TCP family transcription factor |
| Sequence: (in bold interface residues) | 1 MDSKNGINNSQKARRTPKDRHLKIGGRDRRIRIPPSVAPQLFRLTKELGFKTDGETVSWL 60 61 LQNAEPAIFAATGHGVTTTSNEDIQPNRNFPSYTFNGDNISNNVFPCTVVNTGHRQMVFP 120 121 VSTMTDHAPSTNYSTISDNYNSTFNGNATASDTTSAATTTATTTV |
| Interface Residues: | 19, 20, 21, 30, 32 |
| 3D-footprint Homologues: | 7vp2_B, 7vp3_D |
| Binding Motifs: | MA0587.1 GTGGaCCCrs M0753 yrGGtCCACmw M0767 gTkGGGyCCAC MA0587.2 GTGGaCCC |
| Publications: | Viola I.L, Reinheimer R, Ripoll R, Manassero N.G, Gonzalez D.H. Determinants of the DNA binding specificity of class I and class II TCP transcription factors. The Journal of biological chemistry 287:347-56 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.