Transcription Factor
Accessions: | FUS3 (Athamap 20091028), Q9LW31 (JASPAR 2024), T14651 (AthalianaCistrome v4_May2016) |
Names: | B3 domain-containing transcription factor FUS3, FUS3, Protein FUSCA3, FUS3_ARATH, AT3G26790, T14651; |
Organisms: | Arabidopsis thaliana |
Libraries: | Athamap 20091028 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
Uniprot: | Q9LW31 |
Notes: | ecotype:Col-0, experiment type: DAP-seq, family:ABI3-VP1 |
Length: | 313 |
Pfam Domains: | 92-181 B3 DNA binding domain |
Sequence: (in bold interface residues) | 1 MMVDENVETKASTLVASVDHGFGSGSGHDHHGLSASVPLLGVNWKKRRMPRQRRSSSSFN 60 61 LLSFPPPMPPISHVPTPLPARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPA 120 121 LECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQD 180 181 LYSNNYVIQARKASEEEEVDVINLEEDDVYTNLTRIENTVVNDLLLQDFNHHNNNNNNNS 240 241 NSNSNKCSYYYPVIDDVTTNTESFVYDTTALTSNDTPLDFLGGHTTTTNNYYSKFGTFDG 300 301 LGSVENISLDDFY |
Interface Residues: | 97, 99, 104, 105, 106, 108, 147, 149, 150, 151, 152, 154 |
3D-footprint Homologues: | 6j9b_A, 7et6_A, 6fas_B, 6j9c_D |
Binding Motifs: | FUS3 SCATGCAW MA0565.1 yGCATGCrs M0003 ahatrCATGCAwrya MA0565.2 whACATGCAw MA0565.3 ACATGCA |
Binding Sites: | FUS3_2 FUS3_3 FUS3_4 FUS3_1 MA0565.1.1 / MA0565.1.4 MA0565.1.10 / MA0565.1.3 MA0565.1.11 MA0565.1.12 / MA0565.1.13 MA0565.1.14 MA0565.1.15 / MA0565.1.16 MA0565.1.17 MA0565.1.18 MA0565.1.19 MA0565.1.2 MA0565.1.20 MA0565.1.5 MA0565.1.6 MA0565.1.7 MA0565.1.8 MA0565.1.9 MA0565.2.1 / MA0565.2.20 MA0565.2.10 / MA0565.2.8 MA0565.2.11 MA0565.2.12 / MA0565.2.6 MA0565.2.13 / MA0565.2.5 MA0565.2.14 MA0565.2.15 MA0565.2.16 MA0565.2.17 MA0565.2.18 MA0565.2.19 / MA0565.2.20 MA0565.2.2 MA0565.2.3 MA0565.2.4 MA0565.2.7 MA0565.2.9 MA0565.2.19 MA0565.3.1 / MA0565.3.10 / MA0565.3.11 / MA0565.3.12 / MA0565.3.13 / MA0565.3.14 / MA0565.3.15 / MA0565.3.16 / MA0565.3.17 / MA0565.3.18 / MA0565.3.2 / MA0565.3.20 / MA0565.3.3 / MA0565.3.4 / MA0565.3.5 / MA0565.3.6 / MA0565.3.7 / MA0565.3.8 / MA0565.3.9 MA0565.3.19 |
Publications: | Reidt W, Wohlfarth T, Ellerstrom M, Czihal A, Tewes A, Ezcurra I, Rask L, Baumlein H. 2000. Gene regulation during late embryogenesis: the RY motif of maturation-specific gene promoters is a direct target of the FUS3 gene product. Plant J. 21:401-8. [Pubmed] Wang F, Perry SE. Identification of direct targets of FUSCA3, a key regulator of Arabidopsis seed development. Plant Physiol 161:1251-64 (2013). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.