Transcription Factor

						

			
Accessions: Atf4_DBD (HumanTF 1.0)

			
Names: Activating transcription factor 4, Atf4, ATF4_MOUSE, C/ATF, C/EBP-related ATF, cAMP-dependent transcription factor ATF-4, Cyclic AMP-dependent transcription factor ATF-4, Tax-responsive enhancer element-binding protein 67 homolog, TaxREB67 homolog
Organisms: Mus musculus
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q06507
Notes: Ensembl ID: ENSMUSG00000042406; DNA-binding domain sequence; TF family: bZIP; Clone source: Hughes lab.
Length: 91
Pfam Domains:     16-77 bZIP transcription factor
    19-70 Basic region leucine zipper
Sequence: 
(in bold interface residues)		   1 PYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEAL   60
  61 KEKADSLAKEIQYLKDLIEEVRKARGKKRVP
Interface Residues: 28, 29, 31, 32, 35, 36
3D-footprint Homologues: 2wt7_A, 6mg1_B
Binding Motifs: Atf4_DBD aggATGAYGCAATm
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.