Transcription Factor
| Accessions: | Q9BWW7 (JASPAR 2024) |
| Names: | hScrt, Scratch homolog 1 zinc finger protein, SCRT1_HUMAN, Transcriptional repressor scratch 1 |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9BWW7 |
| Length: | 348 |
| Pfam Domains: | 191-213 C2H2-type zinc finger 191-213 Zinc finger, C2H2 type 191-215 C2H2-type zinc finger 222-236 C2H2-type zinc finger 248-270 C2H2-type zinc finger 248-270 Zinc finger, C2H2 type 248-270 C2H2-type zinc finger 263-286 Zinc-finger double domain 276-298 C2H2-type zinc finger 277-298 Zinc finger, C2H2 type 278-298 C2H2-type zinc finger 290-314 Zinc-finger double domain 304-318 C2H2-type zinc finger 304-325 C2H2-type zinc finger 304-325 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MPRSFLVKKVKLDAFSSADLESAYGRARSDLGAPLHDKGYLSDYVGPSSVYDGDAEAALL 60 61 KGPSPEPMYAAAVRGELGPAAAGSAPPPTPRPELATAAGGYINGDAAVSEGYAADAFFIT 120 121 DGRSRRKASNAGSAAAPSTASAAAPDGDAGGGGGAGGRSLGSGPGGRGGTRAGAGTEARA 180 181 GPGAAGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMH 240 241 LLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSA 300 301 FKHFQCKRCKKSFALKSYLNKHYESACFKGGAGGPAAPAPPQLSPVQA |
| Interface Residues: | 201, 202, 204, 205, 208, 232, 233, 234, 235, 236, 238, 239, 240, 241, 242, 258, 259, 260, 261, 262, 265, 266, 286, 287, 288, 289, 290, 291, 292, 293, 294, 297, 309, 314, 315, 316, 317, 318, 320, 321 |
| 3D-footprint Homologues: | 7w1m_H, 5yel_A, 5ei9_F, 6wmi_A, 2i13_A, 7n5w_A, 6jnm_A, 5kkq_D, 2drp_D, 2kmk_A, 8ssq_A, 8ssu_A, 6ml4_A, 8h9h_G, 7eyi_G, 7ysf_A, 2lt7_A, 6a57_A, 2jpa_A, 2gli_A, 1ubd_C, 3uk3_C, 1tf3_A, 8cuc_F, 7y3l_A, 1llm_D, 6blw_A, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 5k5i_A, 5und_A, 1g2f_F, 1tf6_A, 5v3j_F, 4x9j_A, 4m9v_C, 7y3m_I, 6e94_A, 8gn3_A, 2wbs_A, 5yj3_D, 5k5l_F |
| Binding Motifs: | MA0743.1 rwKCAACAGGTGkty MA0743.2 wawkCAACAGGTGgtw MA0743.3 kCAACAGGTG |
| Binding Sites: | MA0743.2.1 MA0743.2.10 / MA0743.2.5 MA0743.2.11 MA0743.2.12 MA0743.2.13 MA0743.2.14 / MA0743.2.6 MA0743.2.15 MA0743.2.16 / MA0743.2.7 MA0743.2.17 MA0743.2.18 MA0743.2.19 MA0743.2.2 MA0743.2.20 MA0743.2.3 MA0743.2.3 / MA0743.2.4 MA0743.2.4 / MA0743.2.5 MA0743.2.6 MA0743.2.7 MA0743.2.8 MA0743.2.9 MA0743.2.10 MA0743.2.11 MA0743.2.12 MA0743.2.13 MA0743.2.14 MA0743.2.15 MA0743.2.16 MA0743.2.17 MA0743.2.18 MA0743.2.19 MA0743.2.20 MA0743.2.8 MA0743.2.9 MA0743.3.1 MA0743.3.10 MA0743.3.11 MA0743.3.12 / MA0743.3.6 MA0743.3.13 / MA0743.3.15 / MA0743.3.17 MA0743.3.14 / MA0743.3.9 MA0743.3.16 MA0743.3.18 MA0743.3.19 MA0743.3.2 MA0743.3.20 MA0743.3.3 MA0743.3.4 MA0743.3.5 MA0743.3.7 MA0743.3.8 |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Nakakura EK, Watkins DN, Schuebel KE, Sriuranpong V, Borges MW, Nelkin BD, Ball DW. Mammalian Scratch: a neural-specific Snail family transcriptional repressor. Proc Natl Acad Sci U S A 98:4010-5 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.