Transcription Factor
| Accessions: | ECK120004533 (RegulonDB 7.5) |
| Names: | ArcA, ArcA transcriptional dual regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | other (mechanical, nutritional, oxidative stress); transcription repressor activity; repressor; operon; activator; Transcription related; cytoplasm; intracellular signal transduction; sequence-specific DNA binding transcription factor activity; negative regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; intracellular; regulation of transcription, DNA-dependent; two-component signal transduction system (phosphorelay); two-component response regulator activity; transcription activator activity; two component regulatory systems (external signal) |
| Length: | 239 |
| Pfam Domains: | 6-112 Response regulator receiver domain 156-232 Transcriptional regulatory protein, C terminal |
| Sequence: (in bold interface residues) | 1 MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGK 60 61 NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR 120 121 TMNLGTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQ 180 181 SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLED* |
| Interface Residues: | 198, 199, 200, 202, 203, 204, 206, 207, 226 |
| 3D-footprint Homologues: | 8jo2_H, 8hih_Q, 4kfc_B, 6lxn_A, 8hml_B, 4nhj_A, 7e1b_B, 5ed4_A, 2z33_A, 5x5l_H, 8b4b_W |
| Binding Motifs: | ArcA wamawwTwrTTAAma |
| Binding Sites: | ECK120011372 ECK120011435 ECK120011512 ECK120011880 ECK120011964 ECK120011968 ECK120011970 ECK120011972 ECK120011974 ECK120011979 ECK120011981 ECK120011983 ECK120011985 ECK120011987 ECK120011989 ECK120011995 ECK120011997 ECK120011999 ECK120012001 ECK120012003 ECK120012005 ECK120012007 ECK120012009 ECK120012011 ECK120012013 ECK120012016 ECK120012018 ECK120012227 ECK120012229 ECK120012231 ECK120012242 ECK120012244 ECK120012341 ECK120012423 ECK120012425 ECK120012427 ECK120012884 ECK120012994 ECK120012996 ECK120013003 ECK120013005 ECK120013007 ECK120013301 ECK120013303 ECK120013305 ECK120013427 ECK120013452 ECK120013480 ECK120013638 ECK120013699 ECK120013701 ECK120013703 ECK120013705 ECK120013801 ECK120013803 ECK120013815 ECK120013817 ECK120013841 ECK120013860 ECK120013910 ECK120013994 ECK120014123 ECK120014128 ECK120014130 ECK120014132 ECK120014134 ECK120014136 ECK120014138 ECK120014140 ECK120014167 ECK120016996 ECK120016998 ECK120017022 ECK120023168 ECK120023169 ECK120023170 ECK120023171 ECK120030258 ECK120030289 ECK120030291 ECK120030684 ECK120033000 ECK120033004 ECK120051323 ECK120051356 ECK120051359 ECK120051362 ECK125110249 ECK125134663 ECK125141248 |
| Publications: | Govantes F., Orjalo AV., Gunsalus RP. Interplay between three global regulatory proteins mediates oxygen regulation of the Escherichia coli cytochrome d oxidase (cydAB) operon. Mol Microbiol. 38(5):1061-73 (2000). [Pubmed] Waegeman H., Beauprez J., Moens H., Maertens J., De Mey M., Foulquie-Moreno MR., Heijnen JJ., Charlier D., Soetaert W. Effect of iclR and arcA knockouts on biomass formation and metabolic fluxes in Escherichia coli K12 and its implications on understanding the metabolism of Escherichia coli BL21 (DE3). BMC Microbiol. 11:70 (2011). [Pubmed] Iuchi S., Lin EC. arcA (dye), a global regulatory gene in Escherichia coli mediating repression of enzymes in aerobic pathways. Proc Natl Acad Sci U S A. 85(6):1888-92 (1988). [Pubmed] Iuchi S., Lin EC. Adaptation of Escherichia coli to redox environments by gene expression. Mol Microbiol. 9(1):9-15 (1993). [Pubmed] Gunsalus RP., Park SJ. Aerobic-anaerobic gene regulation in Escherichia coli: control by the ArcAB and Fnr regulons. Res Microbiol. 145(5-6):437-50 (1994). [Pubmed] Iuchi S., Lin EC. Adaptation of Escherichia coli to respiratory conditions: regulation of gene expression. Cell. 66(1):5-7 (1991). [Pubmed] Lin EC., Iuchi S. Regulation of gene expression in fermentative and respiratory systems in Escherichia coli and related bacteria. Annu Rev Genet. 25:361-87 (1991). [Pubmed] Mika F., Hengge R. A two-component phosphotransfer network involving ArcB, ArcA, and RssB coordinates synthesis and proteolysis of sigmaS (RpoS) in E. coli. Genes Dev. 19(22):2770-81 (2005). [Pubmed] Brondsted L., Atlung T. Anaerobic regulation of the hydrogenase 1 (hya) operon of Escherichia coli. J Bacteriol. 176(17):5423-8 (1994). [Pubmed] Lynch AS., Lin EC. Transcriptional control mediated by the ArcA two-component response regulator protein of Escherichia coli: characterization of DNA binding at target promoters. J Bacteriol. 178(21):6238-49 (1996). [Pubmed] Salmon KA., Hung SP., Steffen NR., Krupp R., Baldi P., Hatfield GW., Gunsalus RP. Global gene expression profiling in Escherichia coli K12: effects of oxygen availability and ArcA. J Biol Chem. 280(15):15084-96 (2005). [Pubmed] Liu X., De Wulf P. Probing the ArcA-P modulon of Escherichia coli by whole genome transcriptional analysis and sequence recognition profiling. J Biol Chem. 279(13):12588-97 (2004). [Pubmed] Perrenoud A., Sauer U. Impact of global transcriptional regulation by ArcA, ArcB, Cra, Crp, Cya, Fnr, and Mlc on glucose catabolism in Escherichia coli. J Bacteriol. 187(9):3171-9 (2005). [Pubmed] Alexeeva S., Hellingwerf KJ., Teixeira de Mattos MJ. Requirement of ArcA for redox regulation in Escherichia coli under microaerobic but not anaerobic or aerobic conditions. J Bacteriol. 185(1):204-9 (2003). [Pubmed] Levanon SS., San KY., Bennett GN. Effect of oxygen on the Escherichia coli ArcA and FNR regulation systems and metabolic responses. Biotechnol Bioeng. 89(5):556-64 (2005). [Pubmed] Compan I., Touati D. Anaerobic activation of arcA transcription in Escherichia coli: roles of Fnr and ArcA. Mol Microbiol. 11(5):955-64 (1994). [Pubmed] Jeon Y., Lee YS., Han JS., Kim JB., Hwang DS. Multimerization of phosphorylated and non-phosphorylated ArcA is necessary for the response regulator function of the Arc two-component signal transduction system. J Biol Chem. 276(44):40873-9 (2001). [Pubmed] Ishige K., Nagasawa S., Tokishita S., Mizuno T. A novel device of bacterial signal transducers. EMBO J. 13(21):5195-202 (1994). [Pubmed] Iuchi S., Lin EC. Mutational analysis of signal transduction by ArcB, a membrane sensor protein responsible for anaerobic repression of operons involved in the central aerobic pathways in Escherichia coli. J Bacteriol. 174(12):3972-80 (1992). [Pubmed] Kwon O., Georgellis D., Lin EC. Phosphorelay as the sole physiological route of signal transmission by the arc two-component system of Escherichia coli. J Bacteriol. 182(13):3858-62 (2000). [Pubmed] Tsuzuki M., Ishige K., Mizuno T. Phosphotransfer circuitry of the putative multi-signal transducer, ArcB, of Escherichia coli: in vitro studies with mutants. Mol Microbiol. 18(5):953-62 (1995). [Pubmed] Georgellis D., Lynch AS., Lin EC. In vitro phosphorylation study of the arc two-component signal transduction system of Escherichia coli. J Bacteriol. 179(17):5429-35 (1997). [Pubmed] Georgellis D., Kwon O., Lin EC. Amplification of signaling activity of the arc two-component system of Escherichia coli by anaerobic metabolites. An in vitro study with different protein modules. J Biol Chem. 274(50):35950-4 (1999). [Pubmed] Georgellis D., Kwon O., Lin EC. Quinones as the redox signal for the arc two-component system of bacteria. Science. 292(5525):2314-6 (2001). [Pubmed] Malpica R., Franco B., Rodriguez C., Kwon O., Georgellis D. Identification of a quinone-sensitive redox switch in the ArcB sensor kinase. Proc Natl Acad Sci U S A. 101(36):13318-23 (2004). [Pubmed] Georgellis D., Kwon O., De Wulf P., Lin EC. Signal decay through a reverse phosphorelay in the Arc two-component signal transduction system. J Biol Chem. 273(49):32864-9 (1998). [Pubmed] Pena-Sandoval GR., Kwon O., Georgellis D. Requirement of the receiver and phosphotransfer domains of ArcB for efficient dephosphorylation of phosphorylated ArcA in vivo. J Bacteriol. 187(9):3267-72 (2005). [Pubmed] Oshima T., Aiba H., Masuda Y., Kanaya S., Sugiura M., Wanner BL., Mori H., Mizuno T. Transcriptome analysis of all two-component regulatory system mutants of Escherichia coli K-12. Mol Microbiol. 46(1):281-91 (2002). [Pubmed] Kato Y., Sugiura M., Mizuno T., Aiba H. Effect of the arcA mutation on the expression of flagella genes in Escherichia coli. Biosci Biotechnol Biochem. 71(1):77-83 (2007). [Pubmed] Mizuno T. Compilation of all genes encoding two-component phosphotransfer signal transducers in the genome of Escherichia coli. DNA Res. 4(2):161-8 (1997). [Pubmed] Toro-Roman A., Mack TR., Stock AM. Structural analysis and solution studies of the activated regulatory domain of the response regulator ArcA: a symmetric dimer mediated by the alpha4-beta5-alpha5 face. J Mol Biol. 349(1):11-26 (2005). [Pubmed] Favorov AV., Gelfand MS., Gerasimova AV., Ravcheev DA., Mironov AA., Makeev VJ. A Gibbs sampler for identification of symmetrically structured, spaced DNA motifs with improved estimation of the signal length. Bioinformatics. 21(10):2240-5 (2005). [Pubmed] McGuire AM., De Wulf P., Church GM., Lin EC. A weight matrix for binding recognition by the redox-response regulator ArcA-P of Escherichia coli. Mol Microbiol. 32(1):219-21 (1999). [Pubmed] Cho BK., Knight EM., Palsson BO. Transcriptional regulation of the fad regulon genes of Escherichia coli by ArcA. Microbiology. 152(Pt 8):2207-19 (2006). [Pubmed] Jeong JY., Kim YJ., Cho N., Shin D., Nam TW., Ryu S., Seok YJ. Expression of ptsG Encoding the Major Glucose Transporter Is Regulated by ArcA in Escherichia coli. J Biol Chem. 279(37):38513-8 (2004). [Pubmed] Sawers G., Suppmann B. Anaerobic induction of pyruvate formate-lyase gene expression is mediated by the ArcA and FNR proteins. J Bacteriol. 174(11):3474-8 (1992). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.