Transcription Factor

Accessions: 5h3r_B (3D-footprint 20231221)
Names: MARR_ECOLI, Multiple antibiotic resistance protein MarR
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P27245
Length: 140
Pfam Domains: 32-91 MarR family
34-100 Winged helix DNA-binding domain
34-92 MarR family
Sequence:
(in bold interface residues)
1 SDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVL 60
61 SVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELT 120
121 KNLTADEVATLEYLLKKVLP
Interface Residues: 49, 54, 63, 64, 65, 66, 68, 69, 73, 90
3D-footprint Homologues: 6qil_A, 7el3_B, 6jbx_A, 3q5f_A, 6c2s_C, 1z9c_A, 5h3r_A, 5hlg_E, 3zpl_B, 4aik_A, 5hso_A
Binding Motifs: 5h3r_AB TnnTTGCCnGGGCAAnnT
Binding Sites: 5h3r_C
5h3r_D
Publications: Zhu R, Hao Z, Lou H, Song Y, Zhao J, Chen Y, Zhu J, Chen PR. Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator. J Biol Inorg Chem 22:685-693 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.