Transcription Factor
| Accessions: | ZSCAN31 (HT-SELEX2 May2017), ZSCAN31 (humanC2H2ZF-ChIP Feb2015), Q96LW9 (JASPAR 2024) |
| Names: | ENSG00000235109, ZSCAN31, Q96LW9, Zinc finger and SCAN domain-containing protein 31, Zinc finger protein 323, ZSC31_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, humanC2H2ZF-ChIP Feb2015 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4, TF family: C2H2;SCAN experiment: ChIP-seq/MEME/B1H-RC |
| Length: | 406 |
| Pfam Domains: | 35-127 SCAN domain 239-261 Zinc finger, C2H2 type 239-259 C2H2-type zinc finger 239-261 C2H2-type zinc finger 254-278 Zinc-finger double domain 266-289 C2H2-type zinc finger 267-289 Zinc finger, C2H2 type 267-289 C2H2-type zinc finger 281-305 Zinc-finger double domain 295-317 C2H2-type zinc finger 295-317 Zinc finger, C2H2 type 295-315 C2H2-type zinc finger 310-332 Zinc-finger double domain 322-332 C2H2-type zinc finger 323-345 C2H2-type zinc finger 323-345 Zinc finger, C2H2 type 338-360 Zinc-finger double domain 351-360 C2H2-type zinc finger 351-373 C2H2-type zinc finger 351-373 Zinc finger, C2H2 type 367-389 Zinc-finger double domain 379-397 C2H2-type zinc finger 379-401 C2H2-type zinc finger 379-401 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRL 60 61 RELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQE 120 121 LSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGE 180 181 SIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHR 240 241 CNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKEC 300 301 GKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAF 360 361 IQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP |
| Interface Residues: | 167, 169, 229, 249, 250, 251, 252, 253, 255, 256, 258, 259, 260, 262, 267, 277, 278, 279, 280, 281, 283, 284, 285, 305, 306, 307, 308, 309, 310, 311, 312, 313, 316, 333, 334, 335, 336, 337, 339, 340, 343, 361, 362, 363, 364, 365, 368, 390, 391, 392, 393, 394, 396 |
| 3D-footprint Homologues: | 5ux0_A, 1ubd_C, 7y3l_A, 7n5w_A, 3uk3_C, 6jnm_A, 8cuc_F, 8ssu_A, 5v3j_F, 1mey_C, 2drp_D, 2gli_A, 8ssq_A, 7w1m_H, 2i13_A, 5kkq_D, 8h9h_G, 6wmi_A, 6a57_A, 2jpa_A, 2kmk_A, 1tf3_A, 2wbs_A, 6ml4_A, 5ei9_F, 6blw_A, 5kl3_A, 1f2i_J, 6u9q_A, 7txc_E, 5und_A, 1g2f_F, 5k5l_F, 1tf6_A, 4x9j_A, 1llm_D, 4m9v_C, 7y3m_I, 6e94_A, 5yel_A, 5k5i_A, 7eyi_G, 7ysf_A, 2lt7_A, 8gn3_A, 5yj3_D |
| Binding Motifs: | MA1722.1 / UN0247.1 / ZSCAN31_2 GCATAAyTGCCCTGCkkCc ZSCAN31_methyl_1 GCATAAyTGCCCyGCdkCc ZSCAN31_ChIP amAAcCAATTAA MA1722.2 GCATAAyTGCCCTGCkkC |
| Publications: | Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.