Transcription Factor
Accessions: | DEAR3 (ArabidopsisPBM 20140210), O22174 (JASPAR 2024), T09273 (AthalianaCistrome v4_May2016) |
Names: | DEAR3, ERF08_ARATH, AT2G23340, T09273; |
Organisms: | Arabidopsis thaliana |
Libraries: | ArabidopsisPBM 20140210 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
Notes: | AP2/EREBP (DREB), ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP |
Length: | 176 |
Pfam Domains: | 27-76 AP2 domain |
Sequence: (in bold interface residues) | 1 METEAAVTATVTAATMGIGTRKRDLKPYKGIRMRKWGKWVAEIREPNKRSRIWLGSYATP 60 61 EAAARAYDTAVFYLRGPSARLNFPELLAGLTVSNGGGRGGDLSAAYIRRKAAEVGAQVDA 120 121 LGATVVVNTGGENRGDYEKIENCRKSGNGSLERVDLNKLPDPENSDGDDDECVKRR |
Interface Residues: | 32, 34, 35, 36, 40, 42, 44, 49, 51, 53, 98, 101, 102, 103, 106 |
3D-footprint Homologues: | 5wx9_A, 1gcc_A, 7wq5_A, 7et4_D, 3mva_O |
Binding Motifs: | DEAR3 gCrCCGmCsw DEAR3_2 bgaACCGACs MA0979.1 CrCCGmCs M0071 wwwTGTCGGTGrhkrhr M0031 wwTGTCGGTGrhd MA1376.2 CrCCGmC |
Publications: | Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.