Transcription Factor
| Accessions: | T084290_1.02 (CISBP 1.02), Q8LG10 (JASPAR 2024), T15468 (AthalianaCistrome v4_May2016) |
| Names: | GATA15, T084290_1.02;, GAT15_ARATH, AT3G06740, T15468; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | experiment type:PBM, family:GATA, ecotype:Col-0, experiment type: DAP-seq, family:C2C2-GATA |
| Length: | 149 |
| Pfam Domains: | 43-77 GATA zinc finger |
| Sequence: (in bold interface residues) | 1 MLDPTEKVIDSESMESKLTSVDAIEEHSSSSSNEAISNEKKSCAICGTSKTPLWRGGPAG 60 61 PKSLCNACGIRNRKKRRTLISNRSEDKKKKSHNRNPKFGDSLKQRLMELGREVMMQRSTA 120 121 ENQRRNKLGEEEQAAVLLMALSYASSVYA |
| Interface Residues: | 52, 53, 55, 66, 70 |
| 3D-footprint Homologues: | 1gat_A, 4hc9_A, 3dfx_B, 3vd6_C, 4gat_A |
| Binding Motifs: | M0761_1.02 yryGATcrr MA1016.1 yryGATcrr M0283 SATCATCATCATCATCATC MA1016.2 GATc |
| Publications: | Jeong MJ, Shih MC. Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis. Biochem Biophys Res Commun 300:555-62 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.