Transcription Factor

Accessions: AtMYB15 (Athamap 20091028)
Names: AtMYB15
Organisms: Arabidopsis thaliana
Libraries: Athamap 20091028 1
1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed]
Uniprot: Q39260
Length: 122
Pfam Domains: 14-61 Myb-like DNA-binding domain
17-76 Myb-like DNA-binding domain
67-112 Myb-like DNA-binding domain
70-117 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNY 60
61 LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDLS 120
121 TS
Interface Residues: 14, 49, 50, 51, 52, 54, 55, 58, 59, 60, 101, 102, 105, 106, 109, 110, 111
3D-footprint Homologues: 3osg_A, 1vfc_A, 1w0t_A, 2kdz_A, 7xur_A, 3zqc_A, 5eyb_B, 6kks_A, 1mse_C
Binding Motifs: AtMYB15 CracGGTAGGTGG
Publications: Romero I., Fuertes A., Benito M. J., Malpica J., Leyva A., Paz-Ares J. More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana. Plant J. 14:273-284 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.