Transcription Factor
Accessions: | O35892 (JASPAR 2024) |
Names: | Nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP100_MOUSE, Speckled 100 kDa |
Organisms: | Mus musculus |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | O35892 |
Length: | 482 |
Pfam Domains: | 20-120 Sp100 domain 379-459 SAND domain |
Sequence: | MEGSDGSPRMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDHEFITGKM YEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLIRRSFGCVF PNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDRRNSNLMQAN QTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYELQINPCFVQLV DVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTTVPSQPAPAYSR KPPTLRRDRGGDTSDTESSIIIRRRKRTGRKKRERLGSYLIRNIKIPMKPSWKTAFLARS ANPSSQRRRKRGPRIPREENADFGGAELPVVCGNAQGFLDKEKFKQGIYVRSIRGKTGRL FTPMDFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQTRRQVN AL |
Binding Motifs: | PB0075.1 rwTwtmCGgAAAwt PB0179.1 ysCGtCGcktaawab |
Publications: | Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.