structure name | CRYSTAL STRUCTURE OF LAGLIDADG MEGANUCLEASE I-GPEMI BOUND TO UNCLEAVED DNA (Ribosomal protein 3homing endonuclease-like fusion protein) |
reference | Hallinan et al. Structure 24 862 2016 |
source | Grosmannia penicillata |
experiment | X-ray (resolution=2.15, R-factor=0.181) |
structural superfamily | Homing endonucleases; |
sequence family | LAGLIDADG endonuclease; |
links to other resources | NAKB PDIdb DNAproDB |
protein sequence | |
interface signature | SRRNKSSEQTSASKCFSISSQQTYKKKFWET |
Estimated binding specificities ?
readout + contact |
A | 7 15 24 8 0 0 0 0 0 19 96 24 0 0 96 61 0 0 0 0 0 0 C | 17 13 24 5 96 96 1 96 89 7 0 24 0 96 0 35 96 96 95 0 0 0 G | 7 17 24 1 0 0 65 0 0 15 0 24 0 0 0 0 0 0 0 0 0 0 T | 65 51 24 82 0 0 30 0 7 55 0 24 96 0 0 0 0 0 1 96 96 96scan! |
Dendrogram of similar interfaces ?
matrix formathome
updated Tue Dec 19 09:46:56 2023